KEGG   Drosophila yakuba: Dyak_GE11805Help
Entry
Dyak_GE11805      CDS       T01068                                 

Definition
GE11805 gene product from transcript GE11805-RA
Orthology
K02089  
cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
dya  Drosophila yakuba
Brite
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     Dyak_GE11805
Protein kinases [BR:dya01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   Dyak_GE11805
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 317 aa AA seqDB search
MSLSRQLKRQKMSQGKKFGDGDPFNYQELNIIGEGAYGTVYRARDVITGNIVALKKVRIS
LNENGVPMSTLREISLLKQLNASNHANIVKLYEVCQFLERDGQLLILLVFEHVEQDLSDL
IDRLPKSGMSPPTIQRLSRELLTGVDFLHSHRIIHRDLKPQNLLVSSQGHLKIADFGLAK
TYGSEMKLTSVVVTLWYRAPEVLLAQPYNSTVDIWSAACIIFEMFNRRALFPGTSEKNQL
DRIFELTGRPTEQQWPQTISVALEHFPQRHPKRPKDFCPQLCKYADDLLNKMLSYDLHLR
PSALACLEHDYFQQEPL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtccctctcacgccagctgaagcggcagaaaatgtcccaggggaagaagttcggcgac
ggcgatcccttcaactaccaggagctgaacatcatcggcgaaggtgcctatggaacggtc
tacagagcccgggatgtgatcaccgggaacattgtggcgctgaagaaggtgcggatatcg
ctgaacgagaacggagtgcccatgtccacactgcgcgaaatctcgctgctgaagcagctg
aatgccagcaatcatgcgaatatagtcaaactgtacgaagtatgccagttcctggagcgc
gacggccaactgctgattctgctggtcttcgagcatgtggagcaggatctctcggatctg
atagacaggctgcccaagtcgggcatgtcgccgcccacaattcagcgcctttcgagggaa
ctgctgaccggtgtggacttcttacactcacaccgcatcatccatcgggatctgaagccg
cagaacctgctggtctcctcgcagggccacctcaagatcgccgactttggcctggccaag
acgtacggatcggagatgaagctcacctcggtggtggtcaccttgtggtaccgcgcaccc
gaagtcctcctcgcccagccctacaacagcaccgtggacatctggagtgccgcctgcatc
atcttcgagatgttcaaccggcgcgctctgttccctggcacctccgagaagaatcagctg
gaccgcatcttcgaactcactggcagacccacggagcagcagtggccgcagaccatttcc
gtggccctggaacactttccccagcggcatccaaagagaccaaaagacttttgcccacag
ctctgcaagtacgccgatgatctgctgaataaaatgctttcctacgacctccacctgcga
ccatccgccttggcctgcttggagcacgactacttccagcaggagcccctatag

DBGET integrated database retrieval system