KEGG   Drosophila yakuba: Dyak_GE11805Help
Entry
Dyak_GE11805      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
dya  Drosophila yakuba
Pathway
dya04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:dya00001]
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Dyak_GE11805
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     Dyak_GE11805
Protein kinases [BR:dya01001]
 Serine/threonine kinases: CMGC group
  CDK family
   Dyak_GE11805
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Haspin_kinase Kdo
Motif
Other DBs
NCBI-GeneID: 6531386
NCBI-ProteinID: XP_002092189
FlyBase: FBpp0256815 FBgn0229597
UniProt: B4P5Y5
Position
2R
AA seq 317 aa AA seqDB search
MSLSRQLKRQKMSQGKKFGDGDPFNYQELNIIGEGAYGTVYRARDVITGNIVALKKVRIS
LNENGVPMSTLREISLLKQLNASNHANIVKLYEVCQFLERDGQLLILLVFEHVEQDLSDL
IDRLPKSGMSPPTIQRLSRELLTGVDFLHSHRIIHRDLKPQNLLVSSQGHLKIADFGLAK
TYGSEMKLTSVVVTLWYRAPEVLLAQPYNSTVDIWSAACIIFEMFNRRALFPGTSEKNQL
DRIFELTGRPTEQQWPQTISVALEHFPQRHPKRPKDFCPQLCKYADDLLNKMLSYDLHLR
PSALACLEHDYFQQEPL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtccctctcacgccagctgaagcggcagaaaatgtcccaggggaagaagttcggcgac
ggcgatcccttcaactaccaggagctgaacatcatcggcgaaggtgcctatggaacggtc
tacagagcccgggatgtgatcaccgggaacattgtggcgctgaagaaggtgcggatatcg
ctgaacgagaacggagtgcccatgtccacactgcgcgaaatctcgctgctgaagcagctg
aatgccagcaatcatgcgaatatagtcaaactgtacgaagtatgccagttcctggagcgc
gacggccaactgctgattctgctggtcttcgagcatgtggagcaggatctctcggatctg
atagacaggctgcccaagtcgggcatgtcgccgcccacaattcagcgcctttcgagggaa
ctgctgaccggtgtggacttcttacactcacaccgcatcatccatcgggatctgaagccg
cagaacctgctggtctcctcgcagggccacctcaagatcgccgactttggcctggccaag
acgtacggatcggagatgaagctcacctcggtggtggtcaccttgtggtaccgcgcaccc
gaagtcctcctcgcccagccctacaacagcaccgtggacatctggagtgccgcctgcatc
atcttcgagatgttcaaccggcgcgctctgttccctggcacctccgagaagaatcagctg
gaccgcatcttcgaactcactggcagacccacggagcagcagtggccgcagaccatttcc
gtggccctggaacactttccccagcggcatccaaagagaccaaaagacttttgcccacag
ctctgcaagtacgccgatgatctgctgaataaaatgctttcctacgacctccacctgcga
ccatccgccttggcctgcttggagcacgactacttccagcaggagcccctatag

DBGET integrated database retrieval system