KEGG   Drosophila yakuba: Dyak_GE11837Help
Entry
Dyak_GE11837      CDS       T01068                                 

Definition
GE11837 gene product from transcript GE11837-RA
Orthology
K04437  
filamin
Organism
dya  Drosophila yakuba
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 1350 aa AA seqDB search
MRPAGQSVPAQVHQSADGVFKAEFVPRVVGEHRVNVTVNGLPTAGSPYAAKVYDVSAIKV
KNVSSGTVGKAVTFLVETSQAGPGNLEVTVNGGRVPTSAQAQGQHTYAISFTPREAESHT
VELRFNSQDVPGSPFTCRVAAAARIQSPETMDKISVGRLFEFVVESDTKPTVEVLGPARR
SVPVKIDPLGSSTLGYNIKFEPMEVGDHSVEVRLPGGGHVEGSPFLLKAYSAEKVIVTDI
RAGVVNKSVSFGINASQAGAGNLEIIVAVNGKNVPNFVQSEGNARFKVNFKPTEAATHSL
SVRFNGHPVPGSPFSCHIAAAAASPSMGLPRAMAMGECLKQAAVKMDNTFELEGFEGVEP
QIFVTSPSGDNEHCQLSQHDGGSYSASFRPTTVGRHLISVTANDQHINGSPFSCNVFDVS
RVSISGLEQQYGPANLGVPVTFSVDAAGAGEGTLELVVSTDSSTVKAEVVACARGLYDVT
FVPQSTEPHYVNITFNEVAVDGSPFRVDIQQHTQHIQIGSLAAIDFPADDQIVEIFSPDQ
KSVPYSINRQTAEFRTHMTGNYTLRFIDRETRQHIGSRTLCVFDPTLVKITEVSEAFCHR
PASIGVSLNEAGQGDLSALVRCGATEVPHTIRGPSKTGVYEIVYQPTRVAPHKISILFNE
VPISLKPLEINVLPASAGKEISVSGLGLYQSRVGKTTSFAIDTVKRPAREFDVVVSGPGG
QALPVRCYQTKNGHLQAEFTINKPGQCVIEVLHQSKPLPGSPFTCESFDSSKVSTQGVTK
EPLALHSPNSFTVRTDNAGTAELEAFAISPSNQSIPVLISEQSDGVYNVEFVPSQPGNYK
LTLMYGGETIPSSPLNFTASSSGVRNDARAAGHGLEVCHRNKEASFVVYCPIAPNVQIER
LDEYGERIEPKIKALGNNEWRISYTILSVGKYEIRASCPNRGSLPGSPWHISCVESNKVT
PVGGWGTLVDHDGRLILPARIVFDVENAGPGKLVCSIDGIEIPVDKLVDGKMCLNITGES
LAAGEHDLDLTWSGLTITQCPRSAFVTGQQAADKVQLMGRGLAAAQAGEAAHFTIDASNA
PAGRPEVILTSQDSTSLPVSLAQPRPSENIWLASYTPLKSTTGTLNLSVKWNGRLVKGCP
LTVAVGSSMDATKVIASGEGLRHGIVGKDIKSWIDTRRAGPGELTAHCAGVRKVAYCELY
DHGDATFTLNIKPQEPGRHLLTIKYGGQNVPGSPFALKVAGAPDASKVRVYGPGIEHGVL
ATFQSRFICDTRGAGAGQLTVRVRGPKGAFRVEMQRESQKDRTILCKYDPTEPGDYRVEV
KWAGEFVPGSPFPVMIFDTEEELRRYLQGI
NT seq 4053 nt NT seq  +upstreamnt  +downstreamnt
atgagaccagctggccaatcggttccggcgcaagtgcatcagtccgccgatggcgtcttc
aaggcggagttcgtgcccagagtcgtgggtgagcatcgggtcaatgtcacggtcaacgga
ttacccaccgccggaagtccatatgcagccaaggtctacgatgtcagcgccatcaaggtg
aagaatgtgagcagtggcacggtgggcaaggcagtcacattcctggtggagacatcccag
gccggacccggcaacctggaggtgaccgtcaacggcggccgggtaccgacctcagcccaa
gcccagggtcagcacacctatgccatcagcttcacgccgcgcgaggctgagagtcacacc
gtggagctgcgcttcaatagccaggatgtaccgggatccccgttcacctgccgcgtggca
gctgccgctcgcatccagtcgccggagaccatggacaagatcagcgtgggtcgactgttt
gagttcgtcgtggagtcggacaccaagccgacggtcgaggtacttggtcctgccagacgg
agtgtgcccgtgaagatagacccactcggttcgtccaccctcggctacaatatcaaattt
gagcccatggaagtaggcgaccactcggtggaggttcgtctgcccggcggtggtcatgtg
gagggcagtccctttctgctgaaggcctactccgccgagaaggtgatagtcacggatatc
cgtgctggcgtggtcaacaagagtgtgagcttcgggatcaatgcctcgcaggcgggtgcc
ggcaatctggagattattgtggccgtcaatggcaagaacgtgcccaactttgttcaatcc
gagggcaatgcccgattcaaggtgaacttcaagcccacggaggcggctacccactcgctg
tcggtgcgattcaatggacatccggtgccgggttcaccattcagctgtcacatcgccgct
gccgccgcttcgccctcgatgggattgccacgggccatggccatgggagaatgcctgaag
caggcggccgtcaagatggacaacacctttgagctggagggctttgagggcgtggagccg
cagatctttgtgacctcgccatcgggcgacaatgagcactgccagttgagccagcacgac
ggaggcagttactccgcctcattccgccccaccaccgtgggtcgtcacctgatcagtgtg
acagctaacgatcagcacatcaacggatcacccttcagctgcaacgtgttcgacgtctcc
agggtgagcatcagtggactggagcagcagtatggaccggccaacctgggcgttccagtc
accttcagcgttgacgctgccggcgctggagagggaaccctggagctggtggtgtccacc
gacagcagcaccgttaaggcagaggtggtggcctgtgcccgtggtctgtacgacgtgacc
tttgtgccccagagcacggaaccccactacgtgaacatcaccttcaacgaggtggccgtg
gatggaagtcccttccgcgtggacatccagcagcacacgcagcatatccagatcggtagt
ttggcggccattgattttccagcggacgatcagatcgttgagatattctcgccggatcag
aagtcggttccgtattcgattaaccggcagacggccgagttccggacccacatgaccggc
aactacaccttgcgctttatcgatcgggagacccgtcagcacattggatcgcgcactttg
tgcgtctttgatcccacgctggtgaagatcaccgaggtgagcgaggccttctgccatcgt
cctgccagcattggtgtgtccttaaacgaagctggccagggtgacctatcggctctggtg
cgttgtggcgccaccgaagtgccgcacaccattcgcggacctagcaaaactggagtgtat
gagatagtttaccagcccacgcgtgtggctccacacaagatcagcatcctcttcaacgaa
gtgcccatttcgctgaaaccgctggagatcaatgtgctgcccgccagtgctggcaaggag
atcagcgtcagtggactgggcttgtatcagtcgcgagtgggcaagaccacttcctttgcc
atcgacacagtcaagaggccagccagggagttcgatgtggtggtctccggaccaggcgga
caagctctaccggtgcgatgttatcagaccaagaacggacacctgcaggcggagttcacc
atcaacaagcccggacagtgtgtcattgaggtactccaccaatcgaagcccctgcccggc
agtccatttacgtgtgaatcctttgacagcagcaaggtcagcacacaaggggtcaccaag
gaaccactggccctacacagtccaaatagtttcacagtacgcacggataatgccggaacc
gctgaactggaggctttcgccatctcgcccagcaatcagagcattcccgtgctcattagc
gagcaatcggatggcgtctacaacgtggagtttgtgccctcgcagccgggcaactacaag
ctgacccttatgtacggaggcgagacgattcccagctcgccgctgaactttaccgcctcg
tccagtggcgtccggaatgacgcccgtgcagctggacacggactggaggtgtgccaccgg
aacaaggaggcatccttcgtggtctactgccccattgcgccaaatgtgcagatcgaacga
ttggacgagtatggtgagcggatagagcccaagatcaaggcactgggcaacaatgagtgg
cgcatctcgtacacaattctgtccgtgggcaaatacgagatacgcgccagctgtccgaac
cgcggaagcttgccgggttcgccgtggcacatcagttgcgtggaatcgaacaaggtgaca
ccggtgggtggttggggcaccctcgttgatcacgatggccggctgattctgcccgctcgc
attgttttcgatgtggagaacgcgggaccgggcaaactggtttgcagcatcgatggcatc
gaaatacccgtggacaagttggtcgacggcaagatgtgccttaacatcacgggcgagagc
ctggccgccggcgagcatgacttggatttgacctggagcggcctgaccatcacccagtgc
cccaggagtgccttcgtcacaggtcaacaggcggcggataaggttcagctaatgggtcgc
ggtctggctgcagctcaggctggcgaggctgcccacttcacgatcgatgcctccaatgcg
ccggctggcaggccggaggtgatcctcaccagccaggacagcacatcgctgccagtgagt
ctggcgcaaccgagaccaagcgagaacatctggctggcctcctacactccgctgaagtcc
acaactggcactctaaatctatctgtcaagtggaacggtcgtttggtcaagggatgtccg
cttacggtggcagtgggctcttcgatggatgccaccaaggtaatagcctccggcgaggga
ctgcgtcacggcattgtgggcaaggacattaagtcctggatagacaccaggcgtgcagga
cccggcgaactcaccgcccattgtgctggtgttcgtaaagtggcctactgtgaactatac
gatcatggcgatgccacatttaccctgaacatcaagccccaggaaccaggtcgccatctg
ctgaccatcaagtacggcggacaaaatgttcccggctcgccatttgccctgaaagtggcc
ggtgcaccggatgccagtaaggtgcgcgtttatggacctggtatcgagcacggcgtgctg
gccaccttccagtcgcgcttcatctgcgacacccgaggagctggagctggtcagctgaca
gttcgggtacgcggacccaagggcgccttccgcgtggagatgcagcgtgagagccagaag
gatcgcaccatcctgtgcaagtacgatccaaccgaaccgggtgactatcgcgttgaggtg
aaatgggcgggcgaattcgtgccaggatcgccgttccccgtcatgatcttcgacactgag
gaggagttacggcggtacttacagggcatatga

DBGET integrated database retrieval system