KEGG   Drosophila yakuba: Dyak_GE11867Help
Entry
Dyak_GE11867      CDS       T01068                                 

Gene name
dyak_GLEANR_12162
Definition
(RefSeq) GE11867 gene product from transcript GE11867-RA
  KO
K03253  
translation initiation factor 3 subunit B
Organism
dya  Drosophila yakuba
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dya00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dyak_GE11867 (dyak_GLEANR_12162)
Messenger RNA biogenesis [BR:dya03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     Dyak_GE11867 (dyak_GLEANR_12162)
Translation factors [BR:dya03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    Dyak_GE11867 (dyak_GLEANR_12162)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 690 aa AA seqDB search
MAKKKSEEHSGADANDSDYQEEPNFEDPPGFVDNISDEDLLGDMLAQRPSEADGVESVVV
VDNIPKVEPERLDKLKSVINKLFSNYGDIVNVVYPVDEDGKTKGYAFMEYKQASQAEEAV
KKLNNHRLDKNHTFAVNLFTDFQKYENIPEKWEPPTVQTFKVQSDLYNFINDPDTYDQYC
VAAETAQNCVQVGFWQNVLPEPFELETRERFTDTFVKWSPLGTYVVTFHKPGVAIWGGSS
FQKIQKFPHPGTQFVEFSPCENYLVTYGPTPTGQKIIIWDIRTGAEKRSFVADGMSVLSM
FRWSHDDKFVARMGENSIHIYETPSFFLLDLKSIKIPGIRGFSWSPTDNVIAYWVEEQNQ
IPARVTLMEIPKKREIRNKNLFHVADCKLHWQKSGDYLCVKVDRYSKLKKDKKDLDVKFL
GMFYNFEIFHMREKEIPVDSVEIRELILAFAWEPIGNKFSIIHGEPNSSNVSFYEVNKGV
KPSLVKRLEKKSCTHLFWSPRGQFIVMANLTMGTFEFVDSTNDYIISASPDHFRASEVEW
DPTGRYVVTGVSSWKVKEDTGFNMYTFQGRIIKRTILKNFVQFLWRPRPPTLLSEEKQKE
IKKNLKKYYAAFEQKDRLRLTRASKELLEKRSQLRETFMEYRNKRIAEWADQKSRRIMLR
GHVDTDNLETDEVDEEIVEFLVKEEVTLLE
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaaagaaaagcgaggagcactccggtgcggatgcaaatgatagcgattaccaa
gaggagccgaactttgaagatccgcccgggtttgtggacaacatcagtgatgaagatctg
ctgggtgacatgttggcccagcgcccctcggaggctgatggcgtcgagagcgtagtggtg
gtggacaacatccccaaggtggagccggagcgactggataagctgaagtcggtcatcaac
aagctgttctccaactacggcgacatcgtcaatgtggtctatcccgtcgacgaggatggc
aagaccaagggctacgccttcatggaatacaagcaggccagccaagcagaggaggccgtc
aagaagctcaacaaccatcgcctggataagaaccacacctttgccgtcaatctctttacc
gatttccagaagtacgaaaacatccccgagaagtgggagccgccaaccgtgcagaccttc
aaggtgcagagcgacctatacaacttcatcaacgacccggacacctatgaccaatactgt
gtggctgcagaaaccgcccaaaactgcgtgcaggtgggcttctggcagaacgtgttgccc
gaaccctttgagctggagacccgcgaacgcttcaccgacaccttcgttaagtggtcgccc
ctgggtacttatgttgtcaccttccacaaacccggcgtggccatctggggtggcagcagc
ttccagaagatccagaagttcccccatcctggtacccaatttgtggagttttcgccctgc
gagaattacctggtgacctacggacccacacccacgggacaaaagatcatcatctgggac
atccgcaccggagccgaaaagcgttcgtttgttgccgatggcatgtcggttctttccatg
ttccgctggtcgcacgacgacaagtttgtggctcgcatgggagagaattcgatccacatc
tacgagacaccctctttcttccttctggacctgaagtccatcaagattcctggcattcgc
ggcttctcgtggtcccccacagacaacgtgatcgcctactgggtggaggagcagaaccaa
atacccgcccgcgttaccttgatggagatccccaaaaagcgtgagatccgtaacaagaat
cttttccatgtggccgactgcaagcttcactggcaaaagtccggcgactatctgtgcgtt
aaggttgatcgctactcaaagttgaagaaggacaagaaggacctggacgtcaagtttctg
ggcatgttctacaacttcgagatcttccacatgcgcgaaaaagagattcccgtagactct
gtagagattcgcgagctcattctggcctttgcctgggagcccatcggcaacaagttctcc
atcattcacggtgagcccaactcgtcgaatgtaagcttctacgaggtgaacaagggcgtg
aagcccagtttggtgaagcgcctggaaaagaagtcctgcacgcatctgttctggtcgcca
cgcggtcagtttatcgtgatggccaaccttaccatgggtacctttgagtttgtggactct
accaacgattacatcatcagcgcatcgcccgatcatttccgcgcctccgaggttgagtgg
gatcccactggacgctacgttgtgactggtgtctcgtcatggaaggtgaaggaggacacc
ggcttcaacatgtacacgttccagggccgcattatcaagcgtaccatcctcaagaacttt
gtgcagttcttgtggcgcccgcgtcctcccactctgcttagcgaagagaagcaaaaggag
atcaagaagaacttgaagaagtactatgctgccttcgaacaaaaggatcgcctgcgcctt
acccgtgcctccaaggagctgctcgagaagcgctcgcagctacgcgagacctttatggag
taccgcaacaagcgtatcgccgaatgggcggatcagaagagtcgtcgcatcatgctgcga
gggcatgtggatacagacaacttggaaaccgacgaagtggatgaagaaattgttgaattt
ttagtcaaggaagaagtcaccctcctggagtag

DBGET integrated database retrieval system