KEGG   Drosophila yakuba: Dyak_GE12020Help
Entry
Dyak_GE12020      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
dya  Drosophila yakuba
Brite
Enzymes [BR:dya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     Dyak_GE12020
Peptidases [BR:dya01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   Dyak_GE12020
Exosome [BR:dya04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   Dyak_GE12020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Peptidase_S9 Thioesterase
Motif
Other DBs
NCBI-GeneID: 6530983
NCBI-ProteinID: XP_002091821
FlyBase: FBpp0257030 FBgn0229795
UniProt: B4PBP9
Position
2R
AA seq 411 aa AA seqDB search
MYEIHNCLRSVFFATLIPGTILLSWLTGLVGLRSLQACLLIFFLIFVLLPLIFRYSVTFQ
RGILFLTFIKYPKGLDLTKPESVGLYATRNFYITVKDHDQDEDGVRVGVWHVLPSNAVRR
FKRELRVEEAVAQDPDQQLDHAPGNERELKELSPAIRSEFPVVLPENEQLFYERLLRMPG
GTVVLYLHGNTASRGSGHRSEVYKLLRKLNYHVFSFDYRGYADSDSVPPTEEGVVRDAMM
VFEYIANTTSNPIVVWGHSLGTGVATHLCAKLASLRERAPRGVILESPFTNIRDEIRMHP
FAKLYKNLPWFNFTISQPMYANKLRFESDVHVLEFRQPIMIIHAEDDVVVPFNLGYRLYR
IALDGRSRTSGPVEFHRFGASRKYGHKYLCRAPELPGLIQKFVENYRDAVY
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgtacgagattcataattgcctaaggtccgttttctttgccacactcattcccggaacg
atcctacttagttggctaactggtctggtgggtctgcggtcgctgcaagcttgtctgctg
atcttcttcctgatcttcgtgcttctgccgttgatctttcggtactccgtaacgtttcag
cgcggcattctattcctgacattcattaagtatcccaaaggacttgatctcacgaagccg
gagagcgtgggactgtatgccacacggaacttctacataaccgtaaaggatcacgatcag
gacgaagatggagtgcgagtgggcgtgtggcacgttctgcccagcaatgcagtgcgtcgt
tttaaacgcgagctgcgcgtggaggaggcagtggcccaggacccggatcagcagctggat
catgcacctggcaacgaacgggagctgaaggaactatcgccagctatacggtctgaattt
cccgttgtgctgccggaaaacgagcagctcttctatgagcgattgctgcggatgccaggt
ggcactgtggtgctctaccttcacgggaacaccgccagccgaggcagcggtcatcggtcg
gaggtgtataagctgctaaggaagctcaactaccatgtgttctccttcgactacagaggc
tatgccgactccgattccgtgcctccgacggaggaaggcgttgtgcgcgatgccatgatg
gtgtttgaatacatagccaacaccacctccaatccgattgtggtctggggtcattccctt
ggcaccggagtggccacgcatctgtgcgccaaactagccagcctacgggaaagggctccc
aggggagtgatcctcgaaagcccattcaccaacattcgggatgagatacgcatgcatccg
tttgccaaactctataaaaatctgccctggttcaattttaccatctcgcaaccaatgtac
gccaataagctgagatttgagtcggatgttcatgtcctggagttccggcaaccaatcatg
atcatccatgcggaggacgacgttgtcgtgccgtttaatctgggctatcgtctgtatagg
atcgcattggatggaagaagtcgaacctcgggacccgttgagttccatcgctttggggcg
agccgaaagtatggacacaaatacctctgccgtgcaccggaattgccgggactgatccaa
aagtttgtggagaactaccgcgatgccgtatactag

DBGET integrated database retrieval system