KEGG   Drosophila yakuba: Dyak_GE12177Help
Entry
Dyak_GE12177      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
dya  Drosophila yakuba
Pathway
dya00790  Folate biosynthesis
dya01100  Metabolic pathways
Module
dya_M00842  Tetrahydrobiopterin biosynthesis, GTP => BH4
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dyak_GE12177
Enzymes [BR:dya01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Dyak_GE12177
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-GeneID: 6530675
NCBI-ProteinID: XP_002091571
FlyBase: FBpp0257187 FBgn0229942
UniProt: B4P9G3
Position
2R
AA seq 271 aa AA seqDB search
MKPQTSEQSGSGQNGEGAADAVAVATIPTGEASAATSGTDLTVSKNSQQLKLEMLNMELA
SNGSGHEKCTFHHDLELDHKPPTREALLPDMARSYRLLLGGLGENPDRQGLIKTPERAAK
AMLYFTKGYDQSLEDVLNGAVFDEDHDEMVVVKDIEMFSMCEHHLVPFYGKVSIGYLPCN
KILGLSKLARIVEIFARRLQVQERLTKQIAVAVTQAVQPAGVAVVVEGVHMCMVMRGVQK
INSKTVTSTMLGVFRDDPKTREEFLNLVNSK
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaagccccagaccagcgagcaaagtggcagtggccagaatggcgagggtgccgcggat
gccgttgccgttgccacgatccccacgggcgaagcctccgccgccacatccggaaccgat
cttacggtctccaaaaacagccagcagctgaaactggaaatgctcaacatggagctggcc
agcaatggaagcggccacgagaagtgcacgttccaccacgacctggagctggaccacaag
ccaccaacgcgagaggccctactcccggacatggcccgctcgtaccgtctccttttgggc
ggcctgggcgagaatcccgaccgccagggactgatcaagacaccggagcgggcggccaag
gccatgctgtacttcaccaagggctatgaccagagtctcgaggatgttctcaacggagcc
gtgttcgacgaggatcatgacgaaatggtcgtagtcaaggacattgaaatgttctccatg
tgcgagcatcatttggtgcctttctacggcaaggtatcaatcggttacttgccgtgcaac
aagattctcggactcagcaaattggcacgcattgtggaaatatttgcgcgtcgcctgcaa
gtacaggagcgcttgactaagcagatcgcagtggccgtgactcaggctgtgcaacctgct
ggagtcgcagttgtagtagagggagtccacatgtgcatggtgatgcgaggcgtgcagaaa
atcaacagcaaaactgttacctcaactatgctgggcgtgttccgagacgatcccaagacc
cgggaggagttcctgaacttagtcaatagcaaatag

DBGET integrated database retrieval system