KEGG   Drosophila yakuba: Dyak_GE12177Help
Entry
Dyak_GE12177      CDS       T01068                                 

Definition
GE12177 gene product from transcript GE12177-RA
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
dya  Drosophila yakuba
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dyak_GE12177
Enzymes [BR:dya01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Dyak_GE12177
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 271 aa AA seqDB search
MKPQTSEQSGSGQNGEGAADAVAVATIPTGEASAATSGTDLTVSKNSQQLKLEMLNMELA
SNGSGHEKCTFHHDLELDHKPPTREALLPDMARSYRLLLGGLGENPDRQGLIKTPERAAK
AMLYFTKGYDQSLEDVLNGAVFDEDHDEMVVVKDIEMFSMCEHHLVPFYGKVSIGYLPCN
KILGLSKLARIVEIFARRLQVQERLTKQIAVAVTQAVQPAGVAVVVEGVHMCMVMRGVQK
INSKTVTSTMLGVFRDDPKTREEFLNLVNSK
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaagccccagaccagcgagcaaagtggcagtggccagaatggcgagggtgccgcggat
gccgttgccgttgccacgatccccacgggcgaagcctccgccgccacatccggaaccgat
cttacggtctccaaaaacagccagcagctgaaactggaaatgctcaacatggagctggcc
agcaatggaagcggccacgagaagtgcacgttccaccacgacctggagctggaccacaag
ccaccaacgcgagaggccctactcccggacatggcccgctcgtaccgtctccttttgggc
ggcctgggcgagaatcccgaccgccagggactgatcaagacaccggagcgggcggccaag
gccatgctgtacttcaccaagggctatgaccagagtctcgaggatgttctcaacggagcc
gtgttcgacgaggatcatgacgaaatggtcgtagtcaaggacattgaaatgttctccatg
tgcgagcatcatttggtgcctttctacggcaaggtatcaatcggttacttgccgtgcaac
aagattctcggactcagcaaattggcacgcattgtggaaatatttgcgcgtcgcctgcaa
gtacaggagcgcttgactaagcagatcgcagtggccgtgactcaggctgtgcaacctgct
ggagtcgcagttgtagtagagggagtccacatgtgcatggtgatgcgaggcgtgcagaaa
atcaacagcaaaactgttacctcaactatgctgggcgtgttccgagacgatcccaagacc
cgggaggagttcctgaacttagtcaatagcaaatag

DBGET integrated database retrieval system