KEGG   Drosophila yakuba: Dyak_GE12190Help
Entry
Dyak_GE12190      CDS       T01068                                 

Definition
GE12190 gene product from transcript GE12190-RA
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
dya  Drosophila yakuba
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dyak_GE12190
Enzymes [BR:dya01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Dyak_GE12190
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     Dyak_GE12190
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 1645 aa AA seqDB search
MLSEGIHWLWRSLLQILMRYQLFRWLQGLIAAVDNEPLPLQIKSDEEAFGEKKKLANLEN
AISPGKSESVAIRTVPSANANANAMGNAGSAEIVSNQIIRRREMSTMGKETESHSIPISE
GQDAEHILYRLKRGSKLSVHPDASLLGRKIVLYTNYPAEGQKFVRTEYRVLGWQLSSGKQ
ITSVMHPEAHVVDTDIRSQVELNISGTYHFYFRYLERPDTGCSGADGALYVQVEPTLHVG
PPGAQKTIPLDSVRCQTLLAKLLGPLDTWEPKLRVAKEAGYNVIHFTPIQELGGSRSCYS
LRDQLKVNSHFAPQKGGKISFEDVEKVIKKCRQEWGVASICDIVLNHTANESDWLLQHPD
ATYSCATCPYLRPAFLLDATFAQCGADIAEGSLEHVGVPAVIEQECHLEALKYQLHTSYL
SKVNIHELYQCDVMKYVNEFMSQVRTREPPKNVANEYRFQEIQLIQDPQYRRLASTINFE
LALEIFNAFHGDCFDEESRFRKCAETLRRHLDALNDRVRCEVQEYINYAIDNVLAGVRYE
RVQGDGPRVKEISEKHSVFMVYFTHTGTQGKSLTEIEADMYTKAGEFFMAHNGWVMGYSD
PLRDFAEEQPGRANVYLKRELISWGDSVKLRFGRRPEDSPYLWKHMTEYVQTTARIFDGV
RLDNCHSTPLHVAEYLLDAARKINPELYVVAELFTNSDYTDNVFVNRLGITSLIREALSA
WDSHEQGRLVYRYGGVPVGGFHANSSRHEATSVAHALFLDLTHDNPSPVEKRSVYDLLPS
AALVSMACCATGSNRGYDELVPHHIHVVDEERTYQEWGKGVDSKSGIMGAKRALNLLHGQ
LAEEGFSQVYVDQMDPNVVAVTRHSPTTHQSVILVAHTAFGYPSPNAGPTGIRPLRFEGV
LDEIILEASLTMQSDKPFDRPAPFNKDPNVINGFTQFQLSLQEHIPLAKSTVFQTQAYVD
GSNTELNFANLRPGTVVAIRVSMHPGPRASFDKLQKISNALRIGSGEEYSQLQAIVSKLD
LVALSGALFSCDDEERDLGKGGTAYDIPNFGKIVYCGLQGFISLLTEISPKNDLGHPFCN
NLRDGNWMMDYIADRLTSYEDLKPLSAWFKATFEPLKNIPRYLIPCYFDAIVSGAYNVLI
NQVNELMPDFIKNGHSFPQSLALSTLQFLSVCKSANLPGFSPALNPPKPPKQCVTLSAGL
PHFSTGYMRCWGRDTFIALRGSMFLTGRYNEARFIILGFGETLRHGLIPNLLDSGSKPRF
NCRDAIWWWMYCIKQYVEDAPKGVEILKDKVSRIFPYDDADAHAPGAFDQLLFDVMQEAL
QVHFQGLQYRERNAGYEIDAHMVDQGFNNQIGVHPETGFVFGGNNFNCGTWMDKMGSSQK
AGNKGRPSTPRDGSAVELIGLQYAVLRFMQSLAEKEVIPYTGVERKGPSGEVTKWSYKEW
ADRIKNNFDKYFFVSESETCSVANKKLIYKDSYGATQSWTDYQLRCNFPITLTVAPDLCN
PQNAWRALERAKKYLLGPLGMKTLDPEDWNYRANYDNSNDSTDCTVAHGANYHQGPEWVW
PIGFYLRARLIFAKKCGHLDETIAETWAILRAHLRELQTSHWRGLPELTNDNGSYCGDSC
RTQAWSVAAILEVLYDLHSLGADVA
NT seq 4938 nt NT seq  +upstreamnt  +downstreamnt
atgctgagcgagggaatccactggctctggaggagcctgctccagatcctgatgcgttat
cagctctttcgatggctgcaaggccttatagcggctgttgataacgaaccgctaccgtta
caaatcaaaagcgacgaggaagcgttcggcgaaaagaagaagctggcgaatctggagaat
gccatctcgcccggaaaatcggaatcagtcgcgattagaaccgttccaagtgcaaatgca
aatgctaatgcaatgggcaatgcaggcagtgccgagatcgtatcaaatcaaatcatccgc
cgccgtgagatgagcaccatgggcaaggagacggagtcgcacagcatacccattagcgag
ggtcaggatgcggagcatattctgtaccgtctgaagcggggttccaagctgagtgttcac
ccggatgcctcgctgctgggcaggaagatcgttttgtacaccaactatcccgctgaggga
cagaagtttgtgcgcacggaatatcgggtactgggatggcagctcagcagtggcaagcag
atcacatctgtaatgcatccggaggcccatgtggtggatacggacattcgtagtcaggtg
gagttgaacatatccggcacctaccacttttacttccgctatctggaaaggcccgacact
ggctgctccggagcagatggagccctatatgtgcaagtggagcccacgctgcatgttggt
ccgccaggcgcccagaagaccatacccctggactcggtgcgctgccaaacgttgctggct
aagctcctgggaccactggacacctgggagcctaagctgcgcgtggccaaggaggccggt
tacaatgtgatccatttcactcccatccaggagttgggtggttcccgatcctgctattcg
ctgcgcgaccaactcaaggtcaactcccattttgcaccacaaaagggaggtaagatcagc
tttgaggatgtggagaaggtcatcaagaagtgtcgccaggaatggggagtggcctccatc
tgcgacatcgtgctcaatcacaccgccaacgagtccgattggctactacagcatccggat
gccacctactcatgcgccacctgtccctacctgcgtcccgcctttctgctggacgccaca
ttcgcccagtgcggagcggacatagccgagggcagcctggagcacgtaggcgtacctgcg
gtcatcgagcaggagtgccatttggaagcgttaaagtaccagttgcacacctcctacttg
tccaaggtcaatatacacgagctgtatcagtgcgatgtgatgaagtacgtgaacgagttc
atgtcccaggtgcgaactcgcgagccaccaaagaatgtggccaacgagtatcgattccag
gaaatccaactgatacaggacccgcaatatcggcgcttggccagcaccattaatttcgag
ctggcgctggagatctttaatgcttttcatggcgactgcttcgatgaggagtcacgcttc
cgcaagtgcgccgaaacccttcgccggcacctcgatgccctcaacgatcgcgtgcgctgc
gaggttcaggaatacatcaactacgccattgacaatgttttggccggagtgcgctacgaa
agagtacagggcgatggacccagagtaaaggagatctccgagaaacactcggtctttatg
gtctactttacgcatacaggcacccagggaaaatcgctcactgagatcgaggcggatatg
tacaccaaggctggagagttcttcatggcccacaatggttgggtcatgggctacagcgat
cctctgagggacttcgctgaggagcaaccgggacgtgccaatgtctacctcaagcgcgag
ctcatctcatggggcgatagtgtaaagctgcgcttcggcaggcggccggaagacagtccc
tacctgtggaaacacatgaccgagtatgttcagaccacggcgcgcatcttcgacggtgtg
cgtttggacaactgccactccacgccattgcacgtagccgagtaccttcttgatgcagca
cgtaagattaatccagagctgtatgtggtggcggaactgttcaccaattccgattacacc
gacaatgtgtttgtaaaccgattgggtatcacctccttgatccgagaagctctttccgca
tgggactcccacgagcaaggccgcctagtctatcgttatggaggagttcccgtgggtggt
ttccatgcgaactcatcgcgccacgaggccaccagtgtggcccatgccctattcctggat
ctcacccacgataacccgtctccagtggagaagcgatccgtatatgatcttctaccatcg
gcagcactggtctccatggcctgctgtgccacaggaagtaaccgtggttacgacgagctg
gttccccatcatatccatgtcgtggacgaggaacgcacctaccaagaatggggcaaggga
gttgactcgaaatcgggaattatgggtgccaaaagagcacttaatttgctgcatggccaa
ctcgcagaggagggatttagccaagtgtacgtagaccagatggatcccaacgtagttgca
gttactcgtcactcgccgaccactcatcagtcagttattctggtggcccacactgccttt
ggttatccctctcctaatgccggccccactggaatccgccctctgcgttttgagggtgtg
ctggacgagatcatcctggaagccagtttgaccatgcagagtgacaagccattcgaccgt
cctgctccgttcaacaaggatccaaatgtaatcaacggctttactcagttccagttgagt
ctgcaggagcacatccctcttgccaagtcgacggtgttccaaacccaggcctatgtggat
ggcagcaacacggagctcaactttgccaatttacggcccggcactgtggtggctatcagg
gtatccatgcatcctggtccgcgtgccagtttcgataagctccagaagatctcgaatgcc
ctgcgtattggctcaggcgaggagtattcgcagctgcaggctatagtttccaagttggat
ctggtagcacttagtggtgccctgttcagctgcgatgatgaggagagggatctgggcaaa
ggtggcactgcctacgacattcccaactttggaaagatcgtttactgcggactgcaagga
ttcatttccctgttgacggagatttcgcccaaaaatgacttgggacatccgttttgtaac
aatctgcgcgatggaaactggatgatggattacatagctgatcgcctcactagttacgaa
gacttgaaaccactctccgcatggtttaaagccacctttgaaccactaaagaatattcca
cgctacctcatcccctgctactttgatgccatcgttagtggggcttacaatgtgctcatc
aaccaggtcaacgaactaatgccagactttattaagaatggccacagtttcccgcagtcc
ctggctttgtccacgttgcagttcctctccgtttgcaagtcggccaatctgccaggattc
agtcctgctctaaatccacccaagcctccaaagcaatgtgtgactctttctgctggtctg
ccgcatttctcaacgggttacatgcggtgctggggccgtgataccttcatcgctctacgt
ggctccatgttcctaaccggccgttacaacgaagcccgcttcatcattcttggatttgga
gagacccttagacacggactcattccgaatcttttggacagcggcagcaagccaagattt
aactgccgcgatgccatctggtggtggatgtactgcatcaagcaatatgtggaggatgcc
cccaagggtgtcgaaattctgaaggacaaggtttcccgcatcttcccgtacgacgatgcg
gatgctcatgcaccaggagcctttgaccagcttctcttcgatgtgatgcaggaggcacta
caggtgcattttcaggggttgcagtatagggagcgcaatgcaggctatgagatcgatgcg
cacatggtggaccagggcttcaacaatcagatcggagtccacccggagacaggctttgtg
ttcggaggcaataacttcaactgcggcacttggatggacaaaatgggatcctcgcagaag
gctggaaacaagggacgaccaagtacgccgcgtgatggatccgccgtggagctcattggc
ctgcagtacgccgtccttcggttcatgcaaagcctagctgaaaaggaggttatcccgtac
accggcgtggaacgaaaaggaccatcgggcgaagtgaccaagtggagctacaaggagtgg
gcggatcgtatcaagaataactttgacaagtatttctttgtgtccgagtcagaaacctgc
tcggtggccaacaagaagctcatctacaaggacagctatggagctacccagagttggacg
gactaccagctgagatgcaacttccccatcaccttgaccgtggcccccgatctgtgcaat
cctcagaatgcctggcgtgcactggagcgcgccaaaaagtatcttctgggaccgcttggc
atgaagaccctggatcccgaggactggaactatagggccaactatgacaactctaatgac
tccacggattgcactgtcgcccatggcgccaactaccaccagggaccggagtgggtatgg
cccattggtttctacctgcgggctcgcctgatcttcgccaaaaagtgtggccatctggac
gagaccattgccgaaacatgggccatactgcgggcccatctccgagagctacagacatcc
cattggcgcggactgcccgagttgaccaacgataatggctcctactgcggtgactcatgt
cgcacacaggcttggagtgttgctgctattttggaggttctatacgatctgcactccttg
ggagcggatgtggcctaa

DBGET integrated database retrieval system