KEGG   Drosophila yakuba: Dyak_GE12395Help
Entry
Dyak_GE12395      CDS       T01068                                 

Definition
GE12395 gene product from transcript GE12395-RA
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dya  Drosophila yakuba
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:dya00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 596 aa AA seqDB search
MSNGRYGRFGALIGVACVSSTHCRFLIYSTKNAEVLAYHELKLRQIVHQAGWMEYDPAEI
WKNTQECIETAYKNLVILEINPHDIIAIGIVNQRGTSVLWNKETGQPLHNAIGWSDCRST
PILKSLLHNVRHNVDYVRYRSGLPLSSCFSALKIRWLMDHVPSVATAIEENKCLFGTLDS
WLLWNLTGGVETGVHSTDLTNAHYTSLLNMSTEQWDPKLCQFFRLPLNILPRIRSNSEIF
GYVLEGPLLGIPIAAMMGEQPASLLGQLCVKAGQNVCTLDDSCFVLLNTGREKLDSANGL
ITGIAHKLGEKEPTNYTLEGAISNAGSTVTWLRDKLQINTEINSNDNVVESLNTFIGENS
MISSSCSSSMLNAECGLAAKRSEITFVPAFHGLYAPYWRHDARGIILGLTSQTTAENITQ
AAYEATGFQIFEVLQAFKRDTPNWDRSCMQPVLTFGGDYAENSHLVQFIADIIGYMLERP
QTTSPAGLGVMITAGVTMKVVSLKYAVKMYTPPTDVFSPTTTKNRRELLYRRWDYAVKKC
LHWNNYETYEADVELFAQRELDPNLPVRRSIPGSAFLISSFALVLLANYLKNNPLK
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacgggcgctacgggagattcggagcactcatcggtgtcgcctgcgttagcagc
acccactgccgctttctgatttactcaacgaaaaatgccgaggtcctggcctaccatgag
ctcaagctgcgtcagattgtccaccaggcgggctggatggagtacgatcctgccgagata
tggaagaacacacaggagtgcatagagaccgcctataagaacctggttatactggagatc
aatccacatgatattattgccatcggcatcgtaaatcaacgcggaacctcggtgttatgg
aacaaggagacgggacagccactgcacaatgccatcggctggtcagattgccgcagtact
cctatcctgaagagcctgcttcataatgttcggcacaatgtggactacgtgaggtatcgc
agtggtttgcccctaagcagctgtttcagtgccctaaagatacgctggcttatggatcac
gttccttctgtggccacggccattgaagagaacaagtgcttattcggcactttggactcc
tggcttctgtggaacctcaccggcggcgtagagactggtgtgcactctacggacctcacc
aatgcccactacacctcccttttgaacatgtccacagagcagtgggatcccaaactttgc
cagttttttcgattgcccctgaacatactgccacgcatacgatccaactccgaaatcttc
ggctacgtgctggagggtcctttgctgggcattcccatagcggccatgatgggtgagcag
ccagcaagtttgctgggtcagctctgcgtgaaggccggtcaaaatgtctgcaccctggac
gatagctgtttcgtgcttcttaacacgggcagggagaaactggactctgcaaatggattg
ataacgggcatagcgcacaagctgggcgaaaaagagcccactaactacacacttgaggga
gccatttcaaatgccggttcaactgtaacatggctgagggataaactgcaaatcaatact
gagattaattccaatgataatgtggtggagtctttgaatacattcatcggcgagaactcg
atgatctcgtcctcctgttcctcgtccatgctgaatgccgagtgtggtctggcggccaag
aggtcggagataacgtttgtgccggcatttcatggtttgtacgctccttactggcgtcac
gatgccaggggcataatcttgggacttaccagccagaccacagcggaaaacatcacccaa
gctgcttacgaggccaccgggttccagatctttgaagtcctacaggcgttcaagcgcgat
acacccaactgggaccgctcctgcatgcagcctgtgcttactttcggcggcgattatgcc
gagaactcgcatctggtgcagttcatagcggacatcatcggctacatgctggagcggccg
cagaccacctcgcctgctggcttgggcgttatgataaccgcgggcgtcacgatgaaagtg
gtgtccctgaaatatgccgtaaaaatgtacaccccgcccacggatgtcttctcgccaaca
actaccaaaaatcgtcgagagctgctctacaggcgctgggattatgcggttaagaaatgc
ctgcactggaacaactatgagacgtacgaggctgatgtcgagctgtttgctcagcgagaa
cttgatcccaatttgcctgttaggcgttctatacccggcagtgcatttctgatttcatca
tttgctctggtcctcctggctaactacttgaagaacaatcccctgaaatag

DBGET integrated database retrieval system