KEGG   Drosophila yakuba: Dyak_GE12519Help
Entry
Dyak_GE12519      CDS       T01068                                 

Definition
GE12519 gene product from transcript GE12519-RA
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dya  Drosophila yakuba
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dyak_GE12519
Enzymes [BR:dya01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Dyak_GE12519
Exosome [BR:dya04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dyak_GE12519
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 685 aa AA seqDB search
MAEAKDIEKLFETDGYLRPFEHEIRRRHGVLEDWLNKINQSEGGLDGFSTAYKHYGLHFQ
PDNSVIAREWAPGAIDVYLTGDFNNWHWESHPFKKLDFGKWELHLPPNEDGSPAIKHMSE
VKIIIRNHSGQLLDRLSPWAKYVVQPPKSANQGVNYKQYVWEPPSYERYQRQHAGPPRPK
SLRIYECHVGIASQEPRVGSYDEFADRIVPRIKRQGYNCIQVMAIMEHAYYASFGYQVTS
FYAASSRYGNPEQLKRMIDVAHSHGLFVLLDVVHSHASKNVQDGLNQFDGTNSCFFHDGA
RGEHSLWDSRLFNYVEYEVLRFLLSNLRWWHDEYNFDGYRFDGVTSMLYHSRGIGEGFSG
DYNEYFGLNVDTDALNYLGLANHLLHKIDSRIITIAEDVSGMPTLCRPVSEGGIGFDYRL
GMAIPDKWIELLKEQSDDEWDMGNLVHTLTNRRWMENTVAYAESHDQALVGDKTIAFWLM
DKEMYTHMSTLSDSSLIIDRGLAMHKMIRLITHALGGEAYLNFMGNEFGHPEWLDFPRVG
NNDSYHYARRQWNLVDDDLLKYKYLNEFDRAMNETEERYGWLHSGPAWVSWKHEGDKIIA
FERAGLVFVFNFHPQRSFTGYRVGTNWAGTYQAVLSSDDPLFGGHNRIDANCKHPSNPEG
YAGRSNFIEVYTPSRTAVVYARVSD
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggctaaggacatcgagaagctgttcgagacggacggctacttgcggccgttt
gagcacgagatccgtcgccgtcatggcgtgctagaggattggctgaacaagataaaccaa
agcgaaggcggactggatggcttttcgacggcttataagcactacggccttcatttccag
cccgacaattcggtgattgcccgggagtgggcacctggagccatagatgtctatctcacg
ggtgacttcaacaactggcactgggaatcgcatccgtttaaaaagctcgacttcggcaag
tgggagctccacctgccccccaacgaggacggcagcccggccatcaagcacatgagcgaa
gttaagattatcattcgcaaccattccggtcaattgctggaccgcctgtcgccctgggcc
aagtacgtggtgcagccccctaagtcggccaaccagggggtcaactacaagcagtacgtt
tgggagccaccatcctacgagcgctatcaacgccagcacgctggtccgcccagacccaag
tcgcttaggatctacgagtgccatgtgggtatcgcctctcaggagccgcgggtcggcagc
tacgacgagtttgccgatcgcattgtgccgcgcatcaagcgccagggctataactgcatc
caggtcatggccatcatggagcacgcttactacgccagttttggctaccaagtgaccagc
ttttatgcagcttccagccgttatggaaacccggagcagctgaagcgcatgatcgacgtg
gcccactcgcacggcctcttcgttctgctggatgtggtacactcgcatgcctccaagaac
gttcaggacggtctgaaccagttcgatggcaccaacagttgcttcttccacgacggagcc
cgtggcgagcactcgctgtgggacagtcgtctcttcaactacgtggagtacgaggtgctt
cgttttctgctatctaacctgcgttggtggcacgacgagtacaacttcgatggctaccgc
tttgacggagtaacctctatgttgtaccattcccggggcattggggagggcttcagcggc
gactacaacgagtacttcggcttgaacgtcgacacggatgcgctcaattatctgggtctg
gccaatcatctgctgcacaaaatagattcgaggattatcactattgcagaggatgtttct
ggaatgcccaccttgtgtcgccccgtttccgagggtggcatcggattcgactaccgcctg
ggtatggccatccccgacaagtggatcgagctgctgaaggagcagagtgacgatgagtgg
gacatgggaaatttggtgcatacgctgaccaaccgtcgctggatggagaacacagtggcc
tacgcagagtctcacgatcaggcgctggtgggcgacaagacgatcgccttctggctgatg
gacaaggagatgtatacacacatgtctacattgtcggactcctcattgatcattgaccgt
ggactggcgatgcacaagatgattcggctgatcacgcacgccctgggaggagaggcgtac
ctgaacttcatgggcaatgagttcggacatcccgaatggctggacttcccgcgcgttggc
aacaacgattcatatcactatgctcggcggcaatggaatctcgtggacgacgatctgctg
aagtacaagtacctcaacgaatttgatcgcgccatgaacgagaccgaggagcgctacggc
tggctgcattccggacccgcatgggtcagctggaagcacgagggcgacaagatcatcgct
ttcgagcgtgccggcctggtgttcgtcttcaacttccatccccagcgaagtttcaccgga
taccgtgtgggcaccaactgggcgggcacctaccaggcggtgctctcctcagacgatcct
ctcttcggcggccacaaccgcatcgacgccaactgcaaacatccctccaatccggagggc
tacgccggtcgctccaatttcattgaggtctacacgccctcacgcaccgccgtggtctac
gcccgcgtcagtgactag

  All links  
No link information was found.   
DBGET integrated database retrieval system