KEGG   Drosophila yakuba: Dyak_GE12591Help
Entry
Dyak_GE12591      CDS       T01068                                 

Definition
GE12591 gene product from transcript GE12591-RA
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
dya  Drosophila yakuba
Pathway
Glycerophospholipid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dyak_GE12591
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dyak_GE12591
Enzymes [BR:dya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dyak_GE12591
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 421 aa AA seqDB search
MRLKSGILLGLLLTTFLDLGECFWPFSKWHESNDPPPPPPEPKRSPVIFVPGDGGSQMDA
RLNKANSPYLICQKTHDWYNLWLDLEQLVIPMVYCWIDNVKLYYDKATRTTHNTPGVETR
IPGWGDPEVVEWIDPTKNSAGAYFKDIANVLVDLGYIRKQNIHGAPYDFRKAPNENQQFF
IDLKQLVEDTYEANNQSAVTFISHSMGSLMTLVFLQEQTVQWKAKYVKRMISLAGVWAGS
FKAVKVFAMGDDLDSFALSAKILKAEQITHPSTAWLLPSPLFWKPSEVLATTPSRNYTMA
QLEEFFYDLDYMTGWEMRKDTIRYNRNFNPPNVELHCLYGDGIDTVERLQYKKSDINGET
PKLIMGLGDGTVNQRSLRACQYWSGYSSAPINTLALQNVDHMHILSNPDVLKYIRTVMKQ
P
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaggctcaaatcgggaatacttttggggctcctgctgaccacttttttggacctgggc
gagtgcttttggccatttagcaaatggcacgaatcaaatgatcctcctcctccgcctcct
gaacccaagagatctccagtgattttcgtacctggcgacggaggctcccaaatggatgct
cgcctgaataaggccaactctccttacttaatttgccagaagacccacgattggtacaat
ctgtggctggacctagagcagttggtcatccccatggtttactgttggatagacaatgtc
aagctgtactacgacaaggcaacaaggaccacccacaatactcctggtgtggagacgagg
atacccggatggggcgatcccgaagtggtcgagtggatcgatcccactaagaacagcgcc
ggagcctactttaaagatatagccaatgtgcttgtggacctgggatatattcgcaaacaa
aatatacacggagcaccctatgacttccgaaaagcgccaaatgagaaccaacaatttttc
attgatcttaagcagctggtggaggacacctatgaggccaacaatcagtctgctgtgacc
tttatctcgcacagcatgggcagtctcatgaccctggtgttcttgcaggaacaaaccgtc
caatggaaggctaaatatgtgaagcgaatgatcagcctggcgggagtatgggcgggaagc
tttaaggctgtaaaggtgtttgccatgggcgatgacctggattcgttcgccctgagtgcc
aagatcctcaaggcggaacagataacacacccatccactgcttggttactgccgtcacca
ctgttttggaagccatccgaggttctggccacgaccccaagcaggaactatacgatggca
cagctcgaagagttcttctacgaccttgactacatgacgggctgggaaatgcgcaaggat
acgattcggtacaaccgaaacttcaatccaccgaatgtggaactccactgtctttatggc
gacggcattgacacggttgagagactgcagtacaagaaatcggacattaatggggaaacg
cccaagttgataatgggtctcggcgacggcactgttaaccagcgctctctgagagcctgt
cagtattggtcgggctattccagcgctcctataaacacattggcccttcaaaacgtggac
cacatgcacatcctgtccaatccggacgtcctcaaatatattcgtactgtcatgaagcag
ccgtaa

DBGET integrated database retrieval system