KEGG   Drosophila yakuba: Dyak_GE12605Help
Entry
Dyak_GE12605      CDS       T01068                                 

Definition
GE12605 gene product from transcript GE12605-RA
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
dya  Drosophila yakuba
Brite
Ribosome [BR:dya03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    Dyak_GE12605
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 204 aa AA seqDB search
MLPIAHGIYRGLVNITRNSRGAFHTASAFRCKAKTSTEENDAAAPEGEGEDNTSSSAPDA
KDRSKAIPVETSIRYLKSAAYKQTYGEDFVWTQYRRNHKGMYAPRKTRKTCIRQNRISTG
NPCPICRDEYLVLDYRNTELLEQFISPHSGDVLSYSKTGLCQKSHLRLMVAVQQARDSGY
LTYDVPFREYDYNEYYGKEQNQKA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgttgccaatagcacatggaatttacagaggcctggtcaacattactcggaatagccgg
ggagcttttcacacggccagcgcctttcgatgcaaggcgaagacttcgactgaagaaaat
gatgcggctgcccctgagggcgaaggagaggataacaccagtagttccgcaccggacgca
aaggatcgcagcaaggctatccccgtggagacctcgattcgatacttaaagagcgccgct
tacaagcaaacctacggcgaggactttgtgtggacgcagtatcggcgcaaccacaagggc
atgtatgcgccgcggaaaacacgaaagacgtgcattcgtcagaaccgtatctcaaccgga
aatccttgtcccatttgccgtgatgagtacttggtactggactaccgcaacacggagctc
ctggagcagttcatatccccccacagcggagacgttctcagctactcaaagacaggcctg
tgtcaaaagagtcatttgcgactaatggtggccgttcagcaagcccgcgactccggatac
cttacatatgatgtgcccttcagggaatatgattacaacgagtactacggtaaggagcag
aatcagaaagcttaa

DBGET integrated database retrieval system