KEGG   Drosophila yakuba: Dyak_GE12756Help
Entry
Dyak_GE12756      CDS       T01068                                 

Definition
GE12756 gene product from transcript GE12756-RA
Orthology
K08738  
cytochrome c
Organism
dya  Drosophila yakuba
Pathway
Sulfur metabolism
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:dya00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 105 aa AA seqDB search
MGAGDAENGKKIFVQKCAQCHTYEVGGKHKVGPNLGGIVGRKCGTAAGYKYTDANIKKGV
TWTEGNLDEYLKDPKKYIPGTKMVFAGLKKAEERADLIAFLKTNK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggtgctggtgatgcggagaacggcaagaagatctttgtgcagaagtgcgcccagtgc
cacacctacgaggtgggcggcaagcacaaggtgggcccaaatctgggcgggattgtgggt
cgcaagtgcggcacagcagcgggatacaagtataccgatgccaacataaagaagggcgtt
acctggacagagggaaatttagacgagtacctcaaggacccgaaaaagtacattcctgga
acgaagatggtgttcgcaggtctcaaaaaggctgaggagcgggccgatttgattgccttt
ctcaagacaaacaagtaa

DBGET integrated database retrieval system