KEGG   Drosophila yakuba: Dyak_GE12756Help
Entry
Dyak_GE12756      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K08738  cytochrome c
Organism
dya  Drosophila yakuba
Pathway
dya04214  Apoptosis - fly
dya04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dya00001]
 Cellular Processes
  Cell growth and death
   04214 Apoptosis - fly
    Dyak_GE12756
   04215 Apoptosis - multiple species
    Dyak_GE12756
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 6529530
NCBI-ProteinID: XP_002090532
FlyBase: FBpp0257766 FBgn0230478
UniProt: B4P9B5
Position
2R
AA seq 105 aa AA seqDB search
MGAGDAENGKKIFVQKCAQCHTYEVGGKHKVGPNLGGIVGRKCGTAAGYKYTDANIKKGV
TWTEGNLDEYLKDPKKYIPGTKMVFAGLKKAEERADLIAFLKTNK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggtgctggtgatgcggagaacggcaagaagatctttgtgcagaagtgcgcccagtgc
cacacctacgaggtgggcggcaagcacaaggtgggcccaaatctgggcgggattgtgggt
cgcaagtgcggcacagcagcgggatacaagtataccgatgccaacataaagaagggcgtt
acctggacagagggaaatttagacgagtacctcaaggacccgaaaaagtacattcctgga
acgaagatggtgttcgcaggtctcaaaaaggctgaggagcgggccgatttgattgccttt
ctcaagacaaacaagtaa

DBGET integrated database retrieval system