KEGG   Drosophila yakuba: Dyak_GE12757Help
Entry
Dyak_GE12757      CDS       T01068                                 

Definition
GE12757 gene product from transcript GE12757-RA
Orthology
K08738  
cytochrome c
Organism
dya  Drosophila yakuba
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:dya00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 108 aa AA seqDB search
MGVPAGDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAAGFAYTDANKAK
GITWNEDTLFEYLENPKKYIPGTKMIFAGLKKPNERGDLIAYLKSATK
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggcgttcctgctggcgatgttgagaagggcaagaagctgttcgtgcagcgctgcgcc
cagtgccacaccgttgaggctggtggcaagcacaaggttggacccaatctgcatggtctg
atcggtcgcaagaccggacaggcggccggattcgcgtacacggacgccaacaaggccaag
ggcatcacctggaacgaggacaccctgttcgagtacctggagaaccccaagaagtacatc
cccggcactaagatgatcttcgccggcctgaagaagcccaacgagcgcggcgatctgatc
gcctacctgaagtcggctaccaagtaa

DBGET integrated database retrieval system