KEGG   Drosophila yakuba: Dyak_GE12767Help
Entry
Dyak_GE12767      CDS       T01068                                 

Definition
GE12767 gene product from transcript GE12767-RA
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dya  Drosophila yakuba
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:dya00040]
Metabolism; Carbohydrate metabolism; Ascorbate and aldarate metabolism [PATH:dya00053]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dya00500]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:dya00830]
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:dya00860]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:dya00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:dya00982]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:dya00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 523 aa AA seqDB search
MIGVRCVLLLLLGVVASTHGANILGLFSSHSPSHLIIHMSVAKALVEAGHNVTVVSMLKP
KVMHKDIHLIVVPMKEEQERTMESQMTEMAGQKNSLVSTMHRLLTSMDVMINAQAELLSD
PRFQRIYETKFDLMILGYFINDFQLGVAHKLSVPVIIDWMSAPVPAIDSYTGNPAELSYV
PLMGTVATHPMGILKRAENVVKSLFFDFIFAVFDYKITRIYNDVFPEQEMPSLKELRKNI
SMAFVGCHLISEGPIRPLVPAIIEIGGIQVKEKPDPLPKDIDQFLSKSQNGAVFLSLGSN
IKSSTVRPEIVQSIFKVLSGLKENVIWKWEDLENTPGNSSNILYKNWLPQDDILAHPNTK
LFITHAGKGGITEAQYHGVPMVALPIFGDQPGNAALMEKSGYGVALDLLSITEDSLKDAL
KKVLEDPKYRRAIGQFSSLYRDRPLTAKQSVVFWTEYILRHHGAPNLQSPAVHMNFIQLN
NLDIYVLILTILVLFVLLTRLVAKIVWNKFGGKAKISNTKKLQ
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgatcggggtccgctgcgtacttttgttgctactcggtgtggtggcctccacccatgga
gctaacattttggggctcttcagcagccacagtccgtcgcatctcatcatccacatgtcg
gtggccaaggcactggtcgaggctggacacaatgtgactgtggtgtccatgctgaagccc
aaggtgatgcacaaggacatccacctgattgtggtgcctatgaaggaggaacaggagcgc
accatggaaagccaaatgactgaaatggccgggcagaagaactcacttgttagcaccatg
catcgccttctaacaagcatggatgtgatgatcaatgcccaggcggagctcctctccgat
cctcggttccagcgcatttacgagaccaaattcgatttaatgattttgggttactttatc
aacgactttcaactgggggtcgcccataagctaagtgtcccggtaatcattgattggatg
tcggcacctgttccggcaattgattcgtatacgggtaatcccgcggagttatcctacgtg
cccctcatgggaactgtggccacgcaccccatgggcatcctaaagcgagctgagaacgtg
gtgaagtccctgtttttcgactttatttttgctgtgtttgattacaaaattacacgaatt
tataatgatgtctttccggaacaagaaatgccatctttgaaggagttaaggaagaatata
tctatggcctttgtcgggtgccacttaatcagtgaaggacctattcgacccctggtgcct
gccattatcgaaatcggaggtatacaagtgaaggaaaagccggatcctctgcccaaggat
atcgatcagttcctaagcaagtcccagaatggtgcggtctttctctctctcggctccaat
atcaagagttctactgtaaggccagaaatcgttcagtctatcttcaaggtcctgtctgga
ctgaaggagaacgttatctggaaatgggaggacttggagaacacacccggtaactcatcc
aatatcctctataagaactggctgccccaagatgacatactggcccatccgaacacgaaa
ctgtttataacacatgctggaaagggcggcattacggaggcccaataccatggcgtgcca
atggtggctttgccgatctttggagatcagcccggaaacgccgccttgatggagaaatct
ggatatggggtggcactggatttgctgtcgataacggaggacagtctaaaggatgccctg
aaaaaggttctggaagatccaaagtacagacgagctatcggccaattctcttccttgtac
agagatcgacccctgactgccaagcagtcggtggttttctggactgagtacatcctgagg
catcatggagcacccaacttgcagagtccagcggtgcacatgaatttcattcagcttaac
aatcttgatatttacgttttaattctgacgattctggtcttgtttgtgctccttacccga
ctagttgcgaaaatcgtgtggaataaatttgggggaaaggcaaagatttcgaatacgaaa
aagctacaataa

DBGET integrated database retrieval system