KEGG   Drosophila yakuba: Dyak_GE12769Help
Entry
Dyak_GE12769      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
dya  Drosophila yakuba
Pathway
dya00040  Pentose and glucuronate interconversions
dya00053  Ascorbate and aldarate metabolism
dya00830  Retinol metabolism
dya00860  Porphyrin and chlorophyll metabolism
dya00980  Metabolism of xenobiotics by cytochrome P450
dya00982  Drug metabolism - cytochrome P450
dya00983  Drug metabolism - other enzymes
dya01100  Metabolic pathways
Module
dya_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dyak_GE12769
   00053 Ascorbate and aldarate metabolism
    Dyak_GE12769
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dyak_GE12769
   00860 Porphyrin and chlorophyll metabolism
    Dyak_GE12769
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dyak_GE12769
   00982 Drug metabolism - cytochrome P450
    Dyak_GE12769
   00983 Drug metabolism - other enzymes
    Dyak_GE12769
Enzymes [BR:dya01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dyak_GE12769
Glycosyltransferases [BR:dya01003]
 Others
  Hydrophobic molecule
   Dyak_GE12769
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_trans_1_3 Glyco_trans_4_2 Glyco_transf_4 Vpu
Motif
Other DBs
NCBI-GeneID: 6529510
NCBI-ProteinID: XP_002090512
FlyBase: FBpp0257779 FBgn0230490
UniProt: B4P995
Position
2R
AA seq 543 aa AA seqDB search
MTQNRSTWIGCSLGGLLVALLALQSMPRGTEGANILGVFTSHSPSHFIVHMSIMKALAEK
GHNVTVVSSVPPKVTHKSIKHIVIPMSAEDEKVLNDGMAGMVKDKPSIWNTMKSIFSSLA
LLIDKQVDVLEDPSFQELYLNKGNKFDVVFVGFFFNTYQVALGARFNCPVIVSWSGPPMM
MVNEVLGNPELSSVPQMHISAPPGQPMNFQQRMQNFASTLGFNALNIFLNHKYNKFYDRL
WGQDKSIPAFEQVKKNVSLAFVNSHGISEGPIRPNVPGVIEIGGIQVKSKPDPLPEDIKE
FLEKGKQGAILFSLGSNLKGEHIQPEVVQTIFKGLSSLKQQVIWKWEDPKNTPGKAANIL
YKKWLPQDDILAHPKIKLFITHAGKGGVAEAQYHGVPMLALPVFADQPGNADKLVASGYG
LQLPLATLDVDEFKASIKEVIDNPKYAKTLKSFSQLYRDRPLSPHESVVYWTEYVIRHHG
AAHMQSPLVHMNFVASNNVDIYIIAALVLYIVFIINKIVWKFVWRKLFGKSNKASQKKKV
KKQ
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaaaccggagcacttggattggttgcagtttgggcggtctcttggtcgcccta
ttggccctgcaatcgatgccccgcggcacagagggagccaacatcctgggcgtcttcacc
agccacagtccgtcgcatttcatcgtgcacatgtccatcatgaaggcgctggccgagaag
ggtcacaacgtgaccgtcgtctcctctgtcccgcccaaagtcactcacaagagcattaag
cacattgtgattccaatgagtgccgaggatgagaaagtgctcaatgatggtatggctggg
atggtcaaggacaagccctcgatctggaacaccatgaaatcgatcttcagctcgctagcc
ctgctcattgataagcaggtggacgttttggaggatccgagctttcaggagctctatctg
aacaagggcaacaagttcgacgtggtcttcgtgggattcttctttaacacgtaccaagtg
gcgttgggtgcccggtttaattgccctgttatcgtttcctggtcgggcccaccaatgatg
atggtcaacgaggtgctgggtaatcccgagctgtccagtgttccccaaatgcatatctcc
gcgccccccggacagcctatgaatttccagcagcgaatgcagaactttgccagcaccttg
ggattcaatgctctcaacatcttcctcaaccacaaatacaacaagttttatgatcgtctt
tggggccaggacaagtcaatacccgcttttgagcaggtcaagaagaacgtctccctggcg
tttgtcaatagccatggcatcagcgaaggtcccatccgtccgaatgtgcctggggtaatt
gaaatcggaggcatccaggtgaagagcaagccagatcccctgccagaggacataaaggag
ttcttggagaaaggaaagcagggagccatcctctttagcttgggctccaacttaaagggc
gaacatatccagcccgaggtggtgcaaacaatattcaagggattgagcagtcttaagcag
caggtgatctggaagtgggaggatcccaagaacacgcccggcaaggcggccaacattctc
tacaagaagtggctgccccaggacgatatcctggcccatcccaagatcaagctgttcatc
acccatgcgggcaagggaggcgtggccgaggcccagtatcatggagtgcccatgctggcg
ctacccgtctttgccgatcagccgggaaatgccgataagctggtggccagtggatatggc
ctgcagctgccgttggccaccctggatgtggacgagtttaaggcatccatcaaggaggtc
atcgataatcccaaatacgcaaagacattgaagagcttctcacagctctaccgcgatcga
cctttgagtcctcatgagtcggtggtctactggacggagtacgtgatccgccatcatggt
gccgcccacatgcagagtcctttggttcacatgaactttgttgccagcaataatgtggac
atttatatcattgccgccctggtgctctacatcgtcttcattatcaacaagatcgtatgg
aaatttgtgtggcgtaaattatttggcaaatcgaacaaagcttctcagaagaagaaggtg
aagaagcagtag

DBGET integrated database retrieval system