KEGG   Drosophila yakuba: Dyak_GE12817Help
Entry
Dyak_GE12817      CDS       T01068                                 

Definition
GE12817 gene product from transcript GE12817-RA
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
dya  Drosophila yakuba
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dya00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dyak_GE12817
Enzymes [BR:dya01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dyak_GE12817
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 433 aa AA seqDB search
MRQLASILLLAFVVGGASAFYSPTDGVVELTPSNFDREVLKDDAIWIVEFYAPWCGHCQS
LVPEYKKLAKALKGVVKVGSVNADADSTLSGQFGVRGFPTIKIFGANKKSPTDYNGQRTA
KAIAEAALAEVKKKVQGVLGGGGGSSSGGSGSSSGDEVIELTEDNFDKLVLNSDDIWLVE
FFAPWCGHCKNLAPEWAKAAKELKGKVKLGALDATAHQSKAAEYNVRGYPTIKFFPAGSK
RASDAQEYDGGRTASDIVSWAGDKHVANVPAPELIEITNESTFETACEGKPLCVVSVLPH
ILDCDAKCRNKFLDTLRTQGEKFKQKLWGWAWAEGGQQLALEESLEVGGFGYPAMAVVNF
KKMKFSVLKGSFSKDGINEFLRDISYGRGHTAPVRGAKKPAIVSVDPWDGKDGQLPTEED
IDLSDIDLDKDEL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaggcaactggcgagcattttgttgctggcttttgtcgtgggcggcgctagtgccttc
tattcgcccaccgacggcgtcgtggagctgacgccctcgaatttcgaccgggaggtgctg
aaagacgacgccatctggatcgtggagttctatgctccgtggtgcggtcattgccagagc
ctggtgcccgagtacaagaagctggccaaggcattgaagggagtcgtgaaagtgggctcc
gtgaatgccgatgcggacagcacgctgagtggccagttcggtgtacgtggctttcccacc
atcaagatctttggcgccaacaagaagtcgcccacggactacaatggtcaacgaaccgcc
aaggcaatcgctgaagctgctctggcggaggtgaagaagaaggtgcagggcgtcctgggc
ggcggcggtggatcgtcttccggcggttccggcagctcatccggcgatgaggtcatcgaa
ctcaccgaggacaacttcgacaaactggtcctgaactccgacgacatatggctggtggag
ttcttcgccccctggtgtggtcactgcaagaatctggcacccgaatgggccaaggccgcc
aaagagctgaagggcaaggtcaagttgggtgccctagatgccaccgcgcatcagagcaag
gccgctgaatacaatgtgcgtgggtaccctaccattaagttcttccctgcgggctccaag
cgagccagtgatgcccaggagtatgatggaggacgcactgcctcggacattgtgtcctgg
gccggtgacaagcatgtggccaatgtgccagcccccgagctcatcgagatcaccaatgaa
tccacgtttgaaactgcctgcgaaggcaagccattgtgcgtcgtgtccgttctgccacac
attctcgattgcgatgccaagtgccgcaacaagttcctcgacacactgcgcacgcagggc
gagaagttcaagcagaagctttggggctgggcctgggctgaaggtggtcagcagttggct
ctggaagagtccctcgaagttggaggattcggctatccggccatggctgtggtcaatttt
aagaagatgaaattctctgtgctcaagggctccttctccaaggacggcatcaacgagttc
ctgcgcgacatctcctacggacgcggccacacggcgcctgttcgcggagccaagaagcca
gcgatcgtgtccgtggatccttgggacggcaaagatggccaactgcccaccgaggaggac
atcgatctgagcgacatcgatctggataaggacgagctgtaa

DBGET integrated database retrieval system