KEGG   Drosophila yakuba: Dyak_GE12917Help
Entry
Dyak_GE12917      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00289  formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
dya  Drosophila yakuba
Pathway
dya00670  One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Dyak_GE12917
Enzymes [BR:dya01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     Dyak_GE12917
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh Formyl_trans_N Formyl_trans_C PP-binding DUF1487
Motif
Other DBs
NCBI-GeneID: 6529215
NCBI-ProteinID: XP_002090222
FlyBase: FBpp0257927 FBgn0230632
UniProt: B4P6W5
Position
2R
AA seq 913 aa AA seqDB search
MALKIKIAIIGQSNFAADVLELLLERSNIQIVGVFTIPDKGSREDILATTATIHNIPVFK
FASWRRKGIALPEVLEQYKSVGATLNVLPFCSQFIPMEVIDGAVLGSICYHPSILPRHRG
ASAISWTLIEGDEVAGFSIFWADDGLDTGPLLLTRQTNLEPTDTLDTIYKRFLYPEGVKA
MGVAVDMVASGTAPKIIQAEVGATYDPAMFKTENQIINLQAPAEKIWNFVRGLDSVPGAI
ATALHDNGSEEQIRLFGAHLYSGGPVSNGKVLRLRGLTKPAWIHSGGLLIEGTDGVFVNI
RRIKRGTKVISASEWFNQAEDQSITDFSEDELAKRTLLAGIWKAILKDEIDSSTDFFASG
AGSMDVVRLVEEVKDAFDVPLQNEQVFMAPVFEEFFSELVRFLRLGSACSGDQQLEFEAF
TLRANKREIRVPTQLFINGEFVDAEAQRTLEIVNPTTEEVLCKVACASATDVDKAVQAAH
SAFYGPWKQITPRQRGQMMLNLADLMERNKEELATIESVDSGAVYTLALKTHVGMSIEAW
RYFAGWCDKIQGNTIPVNPARPNNVLTFTRKEPIGVCGLITPWNYPLMMLSWKMAACIAA
GNTCLIKPAQTCPLTALKFAELTVQAGFPAGVINVLPGKGSDAGQAVADHKLVRKLGFTG
STPIGKHIMKSCADSNLKKCSLELGGKSPLIIFADCDLDKAVRHGMSSVFFNKGENCIAA
GRLFVEDRIHDEFIRRVLKDLRTMTIGDPLDRATAHGPQNHKAHFDKLLEFCKRGVDEGA
KLVYGGCRVPHLKGYFFTPTVFTNVTDDMFIAQEESFGPIMIISKFSGSDVDSLMQRANR
TEYGLASGVFTKDIGKALSFADNIEAGTVFVNVYNKTDVAAPFGGFKQSGYGKDLGHEAL
NEYLKTKCVTVEY
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atggctctaaaaataaaaatcgcaattataggacagagcaatttcgctgctgatgttttg
gagcttctgttggagcgctcaaatatccaaattgtaggagtcttcactattccagataaa
ggcagtcgagaggacattttggcaactactgctaccatccacaatatacctgttttcaag
ttcgcaagctggcgtcgcaagggaatagcactgccagaggtcttggaacaatacaagtct
gtgggcgctactctaaatgttttgcccttctgttctcaattcattcccatggaggtgatt
gacggagcggtattggggagcatttgttaccatccgtctatcctgccacgtcaccgcgga
gctagtgccatatcgtggaccctgatcgagggcgatgaagtggccggcttcagcattttt
tgggctgatgacggtcttgacacaggacccttgctgctaacccggcaaacgaacctggaa
cccacggacacgctggacaccatatacaagcgcttcctataccccgaaggtgtaaaggct
atgggtgtcgctgtggacatggtggccagtggaacggcacccaagataatccaggcggaa
gtgggggcaacctacgacccagctatgtttaaaactgaaaatcagataatcaatcttcag
gccccagctgaaaaaatttggaactttgttcgcggtctggactcagttcctggagccata
gccacggctctgcatgataatggctcagaggagcaaattcgactctttggagctcatctg
tactcaggtggacccgtgtcgaatggaaaggttctacggctaaggggtctaaccaaaccc
gcctggattcacagcggtggtcttcttatagagggaaccgacggtgtctttgtcaacatt
cgccgcattaagcgtggcacaaaggtaatcagcgcgagcgagtggtttaatcaagctgag
gatcagtctataaccgattttagcgaagacgaactggcgaagcgaacgttgctggccgga
atttggaaggcaatactcaaggatgaaatcgactcatcgaccgatttctttgcatccggc
gcaggttcaatggacgtggtacgcttagtcgaggaggtaaaagatgcctttgacgtgccg
ctgcagaacgagcaagttttcatggcccccgtgtttgaggagttctttagcgagctggtt
aggtttcttcgactgggaagtgcctgctccggcgaccagcaactcgaatttgaagcattc
acgctgagggccaacaaaagagagatccgagtgccaacgcaactttttataaacggcgag
tttgttgacgccgaggctcaacgaactttggaaattgttaacccaaccactgaggaagtg
ctttgtaaagtggcctgcgcctcggccaccgacgtggacaaggcagtgcaagcagcccac
tctgctttttatggaccctggaaacagataacacccagacaacgaggtcaaatgatgctc
aacttggctgatctgatggaacgaaataaggaggagctggccactattgagtcagtcgac
tcgggagcggtttacacgctagccctgaaaacccacgttggaatgtccatcgaagcgtgg
cgctactttgccggatggtgcgacaaaatccagggcaacacgattcccgttaacccagcg
agacctaacaacgtattaaccttcacccgtaaggagccaatcggtgtatgcgggttaata
acgccttggaactaccctctgatgatgctttcctggaaaatggccgcctgcattgccgcc
gggaatacatgtctcataaagccagcccagacctgcccgctgactgctctaaagtttgca
gagctaactgtccaggccggatttcccgcaggcgtgatcaatgtcctgcctggaaaaggt
tcagatgcaggacaggcagtggcagaccataagctggtccgcaaacttggtttcaccggg
tccacgcccattggcaagcacattatgaagtcctgcgcagactccaaccttaaaaaatgc
tccctggagctgggcggcaagagcccgctaattatcttcgctgattgtgatttggacaag
gctgtcagacacggtatgtcctcggtgttttttaacaaaggagagaactgcatcgccgcg
ggacgtcttttcgtggaagatcgcatacacgacgaatttatacgacgcgtccttaaggat
ctgcgcaccatgactatcggggacccacttgaccgcgcgacagcccacgggcctcagaac
cacaaggcacactttgacaagctgctggagttttgtaaacgtggggtcgacgagggcgcg
aaactagtgtacgggggatgtcgagtcccacacctcaagggatatttcttcactcccaca
gtgttcacgaacgttacggacgatatgttcattgcccaagaggagtcctttggaccgatt
atgataatatccaagttcagtggcagcgacgtggactccttaatgcagcgtgctaatcgc
acggagtatggcctggccagtggcgtttttacaaaggatattggcaaagcgcttagcttt
gctgataacattgaggccggcactgtttttgtcaatgtatataataagactgatgtggca
gctccatttgggggctttaagcagagcggctatggcaaagatttgggtcatgaggcgctc
aacgagtaccttaagaccaagtgtgttacagttgaatattaa

DBGET integrated database retrieval system