KEGG   Drosophila yakuba: Dyak_GE12985Help
Entry
Dyak_GE12985      CDS       T01068                                 

Definition
GE12985 gene product from transcript GE12985-RA
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
dya  Drosophila yakuba
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dyak_GE12985
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     Dyak_GE12985
    2.7.1.82  ethanolamine kinase
     Dyak_GE12985
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 524 aa AA seqDB search
MSTNLQKATLEEIRHAAARICRDYLTGPWKVVTPQNLVVKRISGGLSNFLYYVSLPNLND
YDELEEQKQQQANVKVSEDVIAATETLTNSSMIFTHDDKSAAKAVGVTLVATKLIKNEDV
TEAAPSAKQAHKRQRCDSDSRDSSSSKRLHALKQEPREVLLRIYGQTHGDHALESMITES
VVFALLSERNFGPKLHGIFPGGRIEQYIPARALTTAELGEQRILMKVAEKMGEIHSLNIP
MSKEPDWIWNCMQRWVSGLESIVSGSVQTNPKSSVVKKQMQLMRTFDYVQEIAWIRSIID
EGEYPVVFCHNDLQEGNILMRQSTAGQNDGTPRESISSLRSNFDETLGDSLDGNSNISDT
ETNKSHSVSPSPCTELDTTNDSALDASFIGDNEPDLIIIDFEYCAYNYRGYDLANHFIEW
TFDYTNPQFPYFYHNSSNCATVQQRRDFIVNYLKKYHDDENYNITGQELIKVDGEIQFFT
MLSHLFWSLWSVINVTSAIEFGYWEYGIARILEYQKLKAAYLAK
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgtctaccaacctgcaaaaggcgacccttgaggaaattcgccatgcggccgcgcgtatt
tgccgagactatctaactggaccctggaaagtggttactccacagaatttggtggtgaag
cgtatcagtggcggtctgtcaaattttttgtattacgtaagccttcccaatttaaatgac
tacgatgagctggaggaacaaaaacagcagcaggcaaatgtcaaagtcagcgaagatgtc
atagcggccaccgaaactctgaccaatagcagcatgattttcactcacgacgataagtcg
gctgccaaggcggttggtgtaacattggtggccacgaaattaataaaaaacgaagacgtc
actgaagcagcaccaagcgccaaacaagcacacaaacgtcagcggtgcgatagtgatagt
cgcgactccagttcttcgaaacgattgcacgccctcaagcaggaaccccgtgaggtccta
ctgcgaatttatggtcagacccatggcgatcacgcgctggagagcatgattaccgagtcc
gtagtattcgcccttctcagtgaacgaaacttcggccccaaactgcacggaatctttccg
ggcgggcgcattgagcaatatattccggcacgcgctttgaccacagcagaattaggagag
caacgaatattgatgaaagttgcagagaaaatgggtgagatccacagtctcaatataccc
atgtctaaagagcccgattggatatggaattgtatgcagcgatgggtttccggtttagag
agcattgttagcggcagtgttcaaacgaatccaaaatcgtcagtagtgaagaagcaaatg
caattgatgcggacttttgactacgttcaagaaatcgcctggattaggtcgattatcgat
gaaggggaatatccagttgtgttctgtcacaatgatctgcaagaaggcaacattctaatg
agacaatcgacagctggtcaaaacgatgggaccccccgggaatctataagtagcctgaga
tccaacttcgatgaaacattgggtgatagccttgatggaaatagcaatatatcggacaca
gagacaaacaaatcacatagcgtgtcgccttcaccatgtactgagctggacactacgaat
gactcagccctggatgccagcttcataggcgataatgagccggatcttattatcattgac
tttgaatattgtgcctacaactaccgtggttatgatcttgccaatcattttattgagtgg
actttcgactacaccaatccacagttcccttacttctaccataactcaagcaactgcgca
actgtgcagcagcgccgcgactttattgtaaactatttaaagaagtatcacgatgacgag
aactataatatcactggtcaggagctgataaaagtagacggtgagattcagttctttaca
atgctgtctcatctattctggagcctttggtccgtaattaatgtcacatcggcgattgag
tttggttattgggaatatggtattgctcgaattctggaatatcaaaagttaaaggcagct
tatctagctaaataa

DBGET integrated database retrieval system