KEGG   Drosophila yakuba: Dyak_GE12987Help
Entry
Dyak_GE12987      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K11252  histone H2B
Organism
dya  Drosophila yakuba
Brite
Chromosome [BR:dya03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    Dyak_GE12987
Exosome [BR:dya04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dyak_GE12987
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like DUF1931
Motif
Other DBs
NCBI-GeneID: 6529211
NCBI-ProteinID: XP_002090218
FlyBase: FBpp0257997 FBgn0230696
UniProt: B4IT09
Position
2R
AA seq 123 aa AA seqDB search
MPPKTSGKAAKKAGKAQKNITKTDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIM
NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgaaaactagtggaaaggcagccaagaaggctggcaaggctcagaagaatatc
accaagaccgacaagaaaaagaagcgcaagaggaaggagagctatgccatctacatttac
aaggttctcaagcaggtccatcctgacaccggcatttcatctaaggcgatgagcatcatg
aacagctttgtaaatgatattttcgagcgcattgctgccgaggcgtctcgtctggctcac
tacaacaagcgctcgaccatcaccagtcgagaaatccaaacggctgttcgcctgcttctg
ccgggagagttggccaagcatgctgtcagtgagggaaccaaggctgtcaccaagtacacc
agctccaaataa

DBGET integrated database retrieval system