KEGG   Drosophila yakuba: Dyak_GE12987Help
Entry
Dyak_GE12987      CDS       T01068                                 

Definition
GE12987 gene product from transcript GE12987-RA
Orthology
K11252  
histone H2B
Organism
dya  Drosophila yakuba
Brite
Exosome [BR:dya04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dyak_GE12987
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 123 aa AA seqDB search
MPPKTSGKAAKKAGKAQKNITKTDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIM
NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgaaaactagtggaaaggcagccaagaaggctggcaaggctcagaagaatatc
accaagaccgacaagaaaaagaagcgcaagaggaaggagagctatgccatctacatttac
aaggttctcaagcaggtccatcctgacaccggcatttcatctaaggcgatgagcatcatg
aacagctttgtaaatgatattttcgagcgcattgctgccgaggcgtctcgtctggctcac
tacaacaagcgctcgaccatcaccagtcgagaaatccaaacggctgttcgcctgcttctg
ccgggagagttggccaagcatgctgtcagtgagggaaccaaggctgtcaccaagtacacc
agctccaaataa

DBGET integrated database retrieval system