KEGG   Drosophila yakuba: Dyak_GE13014Help
Entry
Dyak_GE13014      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K10739  
replication factor A2
Organism
dya  Drosophila yakuba
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:dya00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Dyak_GE13014
   03420 Nucleotide excision repair
    Dyak_GE13014
   03430 Mismatch repair
    Dyak_GE13014
   03440 Homologous recombination
    Dyak_GE13014
   03460 Fanconi anemia pathway
    Dyak_GE13014
DNA replication proteins [BR:dya03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    Dyak_GE13014
DNA repair and recombination proteins [BR:dya03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     Dyak_GE13014
   MMR (mismatch exicision repair)
     Dyak_GE13014
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     Dyak_GE13014
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 244 aa AA seqDB search
MNDSFGDFNATQTAPSGAASSQKGEGIAPLVVKQIVDAPEGNIEMFGMQYAMACVVAIVR
NIETSSTKITYALEDHSGRIDAHYWLEEGDALKAPEVMINNYVKVYGTTRSQGGSKTLMI
FKLLPVLDPNEVCTHLLEVLNARYRAEDYQSKGGAGAGASSGSGSIADFTASQSSAIVSG
LEPKQQAVFQAIKINVSEEGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHF
ICTM
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaatgactcatttggagatttcaatgccacacaaacggcgcccagtggagccgccagt
tctcaaaagggagaaggaatagcgcccctggtggtgaaacagattgtggacgccccggag
ggaaacatcgagatgttcggcatgcagtacgcaatggcctgtgttgtggccatagtgcgg
aacatcgagacttcctcgacaaagattacctacgccctggaggatcatagcggcagaatc
gatgcgcactactggttggaggagggcgacgctctgaaggcacccgaagtcatgatcaac
aactacgtaaaggtctacggcaccacccgatcgcaaggaggttctaaaaccctaatgatc
ttcaagttactgcctgttttggatcccaacgaggtctgcacccacctgctggaagtactc
aatgcccgttacagggccgaggactaccagagtaagggtggagctggtgcaggcgcttcc
tccggctccggctccatagctgatttcacagcctcccagagctcggccattgtcagtgga
ctggagcccaagcagcaggccgttttccaggctatcaagatcaatgtttccgaggagggc
atctcccgcaaggagctgaaagccaaattttcccatatcagcgactctgagttgaccaac
attctggactttatgatatctgagggacacatttattccagcattgacgcagatcacttt
atttgcacaatgtaa

DBGET integrated database retrieval system