KEGG   Drosophila yakuba: Dyak_GE13014Help
Entry
Dyak_GE13014      CDS       T01068                                 

Definition
GE13014 gene product from transcript GE13014-RA
Orthology
K10739  
replication factor A2
Organism
dya  Drosophila yakuba
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:dya03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:dya03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:dya03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:dya03440]
Genetic Information Processing; Replication and repair; Fanconi anemia pathway [PATH:dya03460]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 244 aa AA seqDB search
MNDSFGDFNATQTAPSGAASSQKGEGIAPLVVKQIVDAPEGNIEMFGMQYAMACVVAIVR
NIETSSTKITYALEDHSGRIDAHYWLEEGDALKAPEVMINNYVKVYGTTRSQGGSKTLMI
FKLLPVLDPNEVCTHLLEVLNARYRAEDYQSKGGAGAGASSGSGSIADFTASQSSAIVSG
LEPKQQAVFQAIKINVSEEGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHF
ICTM
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaatgactcatttggagatttcaatgccacacaaacggcgcccagtggagccgccagt
tctcaaaagggagaaggaatagcgcccctggtggtgaaacagattgtggacgccccggag
ggaaacatcgagatgttcggcatgcagtacgcaatggcctgtgttgtggccatagtgcgg
aacatcgagacttcctcgacaaagattacctacgccctggaggatcatagcggcagaatc
gatgcgcactactggttggaggagggcgacgctctgaaggcacccgaagtcatgatcaac
aactacgtaaaggtctacggcaccacccgatcgcaaggaggttctaaaaccctaatgatc
ttcaagttactgcctgttttggatcccaacgaggtctgcacccacctgctggaagtactc
aatgcccgttacagggccgaggactaccagagtaagggtggagctggtgcaggcgcttcc
tccggctccggctccatagctgatttcacagcctcccagagctcggccattgtcagtgga
ctggagcccaagcagcaggccgttttccaggctatcaagatcaatgtttccgaggagggc
atctcccgcaaggagctgaaagccaaattttcccatatcagcgactctgagttgaccaac
attctggactttatgatatctgagggacacatttattccagcattgacgcagatcacttt
atttgcacaatgtaa

DBGET integrated database retrieval system