KEGG   Drosophila yakuba: Dyak_GE13014Help
Entry
Dyak_GE13014      CDS       T01068                                 

Gene name
dyak_GLEANR_13263
Definition
(RefSeq) GE13014 gene product from transcript GE13014-RA
  KO
K10739  
replication factor A2
Organism
dya  Drosophila yakuba
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:dya00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Dyak_GE13014 (dyak_GLEANR_13263)
   03420 Nucleotide excision repair
    Dyak_GE13014 (dyak_GLEANR_13263)
   03430 Mismatch repair
    Dyak_GE13014 (dyak_GLEANR_13263)
   03440 Homologous recombination
    Dyak_GE13014 (dyak_GLEANR_13263)
   03460 Fanconi anemia pathway
    Dyak_GE13014 (dyak_GLEANR_13263)
DNA replication proteins [BR:dya03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    Dyak_GE13014 (dyak_GLEANR_13263)
DNA repair and recombination proteins [BR:dya03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     Dyak_GE13014 (dyak_GLEANR_13263)
   MMR (mismatch exicision repair)
     Dyak_GE13014 (dyak_GLEANR_13263)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     Dyak_GE13014 (dyak_GLEANR_13263)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 244 aa AA seqDB search
MNDSFGDFNATQTAPSGAASSQKGEGIAPLVVKQIVDAPEGNIEMFGMQYAMACVVAIVR
NIETSSTKITYALEDHSGRIDAHYWLEEGDALKAPEVMINNYVKVYGTTRSQGGSKTLMI
FKLLPVLDPNEVCTHLLEVLNARYRAEDYQSKGGAGAGASSGSGSIADFTASQSSAIVSG
LEPKQQAVFQAIKINVSEEGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHF
ICTM
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaatgactcatttggagatttcaatgccacacaaacggcgcccagtggagccgccagt
tctcaaaagggagaaggaatagcgcccctggtggtgaaacagattgtggacgccccggag
ggaaacatcgagatgttcggcatgcagtacgcaatggcctgtgttgtggccatagtgcgg
aacatcgagacttcctcgacaaagattacctacgccctggaggatcatagcggcagaatc
gatgcgcactactggttggaggagggcgacgctctgaaggcacccgaagtcatgatcaac
aactacgtaaaggtctacggcaccacccgatcgcaaggaggttctaaaaccctaatgatc
ttcaagttactgcctgttttggatcccaacgaggtctgcacccacctgctggaagtactc
aatgcccgttacagggccgaggactaccagagtaagggtggagctggtgcaggcgcttcc
tccggctccggctccatagctgatttcacagcctcccagagctcggccattgtcagtgga
ctggagcccaagcagcaggccgttttccaggctatcaagatcaatgtttccgaggagggc
atctcccgcaaggagctgaaagccaaattttcccatatcagcgactctgagttgaccaac
attctggactttatgatatctgagggacacatttattccagcattgacgcagatcacttt
atttgcacaatgtaa

DBGET integrated database retrieval system