KEGG   Drosophila yakuba: Dyak_GE13209Help
Entry
Dyak_GE13209      CDS       T01068                                 

Gene name
Dyak_lola
Definition
GE13209 gene product from transcript GE13209-RA
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dya  Drosophila yakuba
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dyak_GE13209 (Dyak_lola)
   00053 Ascorbate and aldarate metabolism
    Dyak_GE13209 (Dyak_lola)
   00500 Starch and sucrose metabolism
    Dyak_GE13209 (Dyak_lola)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dyak_GE13209 (Dyak_lola)
   00860 Porphyrin and chlorophyll metabolism
    Dyak_GE13209 (Dyak_lola)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dyak_GE13209 (Dyak_lola)
   00982 Drug metabolism - cytochrome P450
    Dyak_GE13209 (Dyak_lola)
   00983 Drug metabolism - other enzymes
    Dyak_GE13209 (Dyak_lola)
Enzymes [BR:dya01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dyak_GE13209 (Dyak_lola)
Glycosyltransferases [BR:dya01003]
 Others
  Hydrophobic molecule
   Dyak_GE13209 (Dyak_lola)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 519 aa AA seqDB search
MWSPRVVLLFLALALSQPNELVEAAGPLKVLGLFPHPGVSHFHFFHPIMKGLAEAGHDVS
VVSHFPDKHPVAHYKDFPLTGMDKLTNSVDLKFFEKRTFYSHFQEFFLLHEWGKQSCNLT
LRSEALQQILRRPGRFDIIIMEQFNTDCMMGVAHQLQAPVIALSSCVMMPWHYERMGAPL
IPSHIPALFMAQSQHMDFGGRLANWFSTHALNWMYKLLSVPAADAMVQYKFGHDVPSVGE
LVKNTSMFFVNQHYSLSGPKITPPNIIELGGVHIQKSKPLPADLQRILDNAEEGVVLISW
GSMIRANSLSAAKRDGIIRAVARLKQKVIWKWENETLPNQPPNMYIMKWLPQRDILCHPN
VKVFMSHGGLMGTSEAAYCGVPVVATPMYGDQFVNTAALVERGMGTILNFEDIGENTVMR
ALKKALDKKFHDAAKVVSHSFHHRPQQALHTAIWWVEHVAHTGGDPLLKPSAVQMSRFVY
YSLDVYAVLTLVLGSIIASWVWLLRLCCGSSAAQKSKRD
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgtggtcaccgcgggttgtactccttttcctggcccttgcacttagccaaccaaacgag
ttggtggaggccgctggtccgctgaaggtgctgggtctgtttccccatcccggagttagc
cacttccacttcttccaccccatcatgaaaggtctggccgaggcgggacatgacgtgagc
gtggtttcccacttcccggacaagcatccggttgcccactacaaggatttccccctcacc
gggatggacaagctcacgaacagtgttgatctcaagttttttgagaagcgcacattctac
agtcacttccaggagttcttcctgctgcacgagtggggcaagcagtcctgcaacctaacg
ctccgttcggaagcactgcagcagatcctcagacgtccgggacgctttgatattatcatc
atggagcaattcaacaccgactgcatgatgggggtggcccaccagctccaggcgccggta
atcgccctgagcagctgtgtgatgatgccctggcactacgagagaatgggagctcctttg
ataccctcccacatcccggcgctctttatggcccagtcccagcacatggactttggcgga
cgactggccaattggtttagcacccatgccttaaattggatgtacaaattactatcggtt
cccgctgccgatgccatggttcagtacaaatttggacacgacgtgccttcggtgggtgag
ctggtgaagaacacatccatgttctttgtaaaccagcactactcgctgtcaggacccaaa
ataacgccgcccaatatcatcgaactgggtggcgtacatatccagaaatcgaaacccctg
cccgctgatctgcagcgcatcttggacaatgccgaggaaggagtggtcctgatcagttgg
gggtcaatgatccgggcgaattccctgtcggcggcgaaaagagatggcatcattcgggcg
gtggctcgattgaagcagaaagttatctggaaatgggagaacgaaaccttgcctaatcag
ccacccaacatgtacattatgaagtggttgccacaacgcgatatcctctgtcatcccaac
gtcaaggtgttcatgtcccacggcggactcatgggcacctcggaggcagcttactgcgga
gtcccagttgtggctacgcccatgtatggcgatcaattcgtcaatacagccgctttggtc
gagcgaggcatgggcactatcctgaatttcgaggacataggggaaaacacggtgatgagg
gcactgaagaaggcattggacaagaagttccatgatgctgccaaggtcgtctcccactct
tttcaccaccgccctcagcaggccctgcatacagccatttggtgggtagagcatgtggcc
cacacaggcggagatcctctgctgaagcccagtgccgtccagatgtcccgattcgtgtac
tactccctggacgtctatgcggtgttgaccctggttctgggcagcatcattgccagttgg
gtgtggctccttcgactctgctgcggatccagtgccgcccagaagtctaagagggactag

DBGET integrated database retrieval system