KEGG   Drosophila yakuba: Dyak_GE13430Help
Entry
Dyak_GE13430      CDS       T01068                                 

Definition
GE13430 gene product from transcript GE13430-RA
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
dya  Drosophila yakuba
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:dya00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:dya00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:dya00471]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 716 aa AA seqDB search
MLKGVPTLAGRNLRLLTTQAQVLVHQRAKASAAEPVEEFDQETDLLKRLRFGHTGKQLQQ
KIINEKKLRAPPLMNLVFANRKLSFYDTSSTPKTKEDNAKLTQRRHYSMRPHREQEQRNA
EDVLFDMFASEETGLISMGKFLAGLKTTGIRRNDPRVRELMENLKKVHKLNNYETGSSAE
TQHLNRETFKAVVAPNIVLIAKAFRQQFVIPDFTSFVKDIEDIYNRCKTNTLGKLADYIP
QLARYNPDSWGLSICTIDGQRFSIGDVDVPFTLQSCSKPLTYAIALEKLGPKVVHSYVGQ
EPSGRNFNELVLDQNKKPHNPMINAGAILTCSLMNALVKPDMTSAEIFDYTMSWFKRLSG
GEYIGFNNAVFLSEREAADRNYALGFYMRENKCFPKRTNLKEVMDFYFQCCSMETNCEAM
SVIAASLANGGICPTTEEKVFRPEVIRDVLSIMHSCGTYDYSGQFAFKVGLPAKSGVSGG
MMLVIPNVMGIFAWSPPLDHLGNTVRGLQFCEELVSMFNFHRYDNLKHLSNKKDPRKHRY
ETKGLSIVNLLFSAASGDVTALRRHRLSGMDITLADYDGRTALHLAASEGHLECVKFLLE
QCHVPHNPKDRWGNLPVDEAENFGHSHVVEFLRSWAEKADLSNEECNPEAVTSKTQADEE
ICSTSDLETSPTTSPIPTPVESGSRAGSGRSSPVPSEAGSTASVGSSIDDKTKPGL
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaaggtgttcccacgctagccggtcgaaaccttcgtcttctgacgacccaggca
caggtgctggtccatcagcgcgccaaggcgtccgccgccgagcccgtcgaggaatttgac
caggagacggatctcttgaagcgcctcaggttcggacacacgggcaaacagctgcagcag
aaaataatcaatgagaaaaaactgcgcgctccaccgcttatgaacttggtgtttgccaat
cgaaagttgtccttctacgataccagttccacgccaaagaccaaagaggataatgccaag
ctcactcagagacgccactattcgatgcggccccatcgcgagcaggagcaacgaaatgcg
gaggatgtgctattcgacatgttcgccagcgaggagacgggcctcatctcgatgggcaag
ttcctggccgggctaaagaccaccggcatacgcaggaatgatccaagagtgcgcgagcta
atggaaaacttgaagaaggtgcacaagctgaataactacgagacgggctcttcggcggaa
acgcagcatctcaatcgggagaccttcaaggctgtggtggcccccaatattgtgctgatt
gccaaggccttcaggcagcagttcgtgatccccgactttacgagcttcgtcaaggacatc
gaggacatctacaaccgctgcaagaccaacacactgggcaagttggccgactacattccg
cagctggctcgctataatcccgattcgtggggcctgagcatctgcaccattgatggacag
cgcttctccatcggcgatgtggatgtgcccttcacactccagagttgcagcaagccactg
acctacgccattgccctggagaagctgggccccaaggtggtgcactcgtatgtgggccag
gagccgagtggcaggaacttcaacgagctcgtcctggatcagaacaaaaaaccgcacaat
ccgatgatcaacgctggtgccatccttacctgctccctgatgaacgccttggtgaagccg
gacatgacctccgctgagatcttcgactacaccatgtcctggttcaagcgcctgtccggc
ggagagtacatcggcttcaacaacgccgtattcctgtccgaacgtgaggccgccgatcgg
aactacgcgctgggcttctacatgcgggagaataagtgcttccccaagcgcaccaatctt
aaggaggtgatggacttctacttccagtgctgctccatggagaccaactgcgaggcaatg
tccgtgatcgccgccagtttggccaacgggggcatctgtcccaccaccgaggagaaggtc
ttccggccggaggtcatccgggatgtgctctcgatcatgcactcctgcggcacgtacgac
tactccgggcagttcgccttcaaggtgggtctgccagccaagtccggagttagtggcggc
atgatgctggtcatccccaacgtaatgggcatcttcgcctggtccccgcccttggaccac
ttgggcaacacagtgagaggactacagttttgtgaggagctggtctccatgttcaatttc
catcgctacgacaacctgaagcatctgtccaacaaaaaggatccaaggaagcaccgctac
gagacaaagggtctgtccatcgtcaatctgctcttttcagctgccagcggagatgttacg
gccttgcgccgtcatcgactctccggaatggacatcaccctggccgactacgatggtcgc
actgccctccatttggctgcctccgagggacacttggagtgcgtgaagttcctgctggag
cagtgtcatgtaccccacaatcccaaggatcgttggggcaatctgcccgtggatgaggcc
gagaactttggccacagtcacgtggtggagttcctgcgctcctgggccgagaaggccgat
ctgtccaacgaggagtgcaaccccgaggcggtgaccagcaagacacaagcggatgaggaa
atctgcagcacaagcgatttggagaccagtccgaccaccagtcccattcccacccccgtg
gaatccggatccagggcaggatccgggcggtccagcccggtgccatcggaagcgggcagt
acggcgagcgtcggaagcagcatcgatgataaaaccaagccgggactatag

DBGET integrated database retrieval system