KEGG   Drosophila yakuba: Dyak_GE13443Help
Entry
Dyak_GE13443      CDS       T01068                                 

Definition
GE13443 gene product from transcript GE13443-RA
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
dya  Drosophila yakuba
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Dyak_GE13443
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Dyak_GE13443
   00603 Glycosphingolipid biosynthesis - globo series
    Dyak_GE13443
   00604 Glycosphingolipid biosynthesis - ganglio series
    Dyak_GE13443
   00511 Other glycan degradation
    Dyak_GE13443
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dyak_GE13443
Enzymes [BR:dya01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Dyak_GE13443
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 660 aa AA seqDB search
MSLAVSLRRALLVLLTGAIFILTVLYWNQGATKAQAYNEALERPHSHHDASGFPIPVEKS
WTYKCENDRCMRVGHHGKSAKRVSFISCSMTCGDINIWPHPTHKFLLSSQTHSFSVEDVQ
LHVETSHREVRKQLQLAFDWFLKDLRQIQRLDYVGSSSEPTVSESSSKSRHHADVDPAAT
LFGATFGVKKVGDLTSIQVKISVLKSGDLNFSLDNDETYQLSSLTEGRRLQVEITANSYF
GARHGLSTLQQLIWFDDEDHLLHTYANSKVKDAPKFRYRGLMLDTSRHFFSVESIKRTIV
GMGLAKMNRFHWHLSDAQSFPYISRYYPELAEHGAYSESETYTEQDVREVAEFAKIYGVQ
VIPEIDAPAHAGNGWDWGPKRGMGELAMCINQQPWSFYCGEPPCGQLNPKNNHTYLILQR
LYEELLQHTGPTDLFHLGGDEVNLDCWAQYFNDTDLRGLWCDFMLQAMARLKLANNGVAP
KHVAVWSSALTNTKCLPNSQFTVQVWGGSTWQENYDLLDNGYNVIFSHVDAWYLDCGFGS
WRATGDAACAPYRTWQNVYKHRPWERMRLDKKRRKQVLGGEVCMWTEQVDENQLDNRLWP
RTAALAERLWTDPSDDHDMDIVPPDVFRRISLFRNRLVELGIRAEALFPKYCAQNPGECI
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgtccttggctgtatcgctgcgccgagctctgttggtgctgctcaccggcgccatattc
atcctgacggtgctctactggaaccaaggagccaccaaggcccaggcttacaatgaggcg
ctggaacgcccccacagccatcacgatgccagtggctttcccatacccgtcgagaagtcc
tggacgtacaagtgcgagaatgaccgatgcatgcgggtgggccatcatggaaaatccgcc
aagagggtctcgttcatcagctgctcgatgacgtgcggtgacattaacatttggccgcac
cccacccacaaattcctgctcagctcccagacgcacagcttctccgtggaggatgtgcag
ctgcacgttgagacgtcgcatcgcgaggtgcgcaagcagctccaactggcttttgactgg
ttccttaaggatctgaggcaaatccagcggctggactacgtgggtagttcatcagagccg
accgtaagcgaatcctcttcgaagtcacgccaccatgcagatgtggatccagctgccacg
ctttttggtgctacctttggggtgaagaaggttggtgatttaaccagcatacaggtcaag
atcagcgtgctcaagtccggagaccttaactttagcctggacaatgatgagacctaccag
cttagctccctaaccgaaggacgccgcctgcaggtggagatcaccgcaaactcctacttc
ggagcccggcatggactgtctacgctgcagcaactgatatggtttgacgacgaagatcac
ctgttgcacacttatgccaatagcaaggtgaaggatgcccccaagttccggtatcgaggc
ctcatgctggacacctctcgccacttcttctctgtggagtccatcaagcgcacgattgtg
ggcatgggcctggccaagatgaaccgcttccactggcacctctctgacgcccagagtttc
ccttacatttcgcgctactatccagagctggccgagcatggagcttactcggagagcgag
acgtacacggaacaagatgttcgcgaggtggccgagttcgccaagatttatggtgttcaa
gtcatacccgagatcgatgcgcctgcccatgcgggcaacggctgggattggggacccaag
cgtggaatgggcgagctggccatgtgcatcaaccagcagccatggagcttctactgcggc
gaaccgccgtgcggacagctgaatccgaagaataaccatacctacctcattctgcagcgc
ctctacgaggagttgttgcaacacacaggtcccacggacctcttccacctgggcggtgac
gaggtgaatcttgattgctgggcccaatacttcaacgatacagatcttcgcggattgtgg
tgcgatttcatgctccaggctatggctagactaaaactggccaacaatggagtagcgccc
aagcacgtggctgtctggtcgagcgccctgaccaacaccaagtgtcttccaaacagtcaa
ttcaccgtccaggtatggggcggcagcacttggcaggagaactacgatttgctggacaac
ggctacaacgtaatcttctcgcacgttgacgcctggtatctggactgcggcttcggtagc
tggcgggccactggggatgccgcctgtgctccgtaccgcacttggcagaatgtctacaag
cacaggccgtgggagcgcatgcgattggacaagaagcgaaggaagcaagtgctcggtggc
gaagtgtgcatgtggaccgagcaggtggacgaaaaccagctagacaaccggctgtggccc
cgaacagccgctctggcggagcgcttgtggaccgatcctagcgatgatcacgatatggac
atagtgccgccagatgtattccgcagaatctcactgtttcgaaatcgcctcgtcgaactg
ggcatccgggctgaagcgctgtttccaaaatactgtgcccagaatcccggcgaatgcatt
tga

DBGET integrated database retrieval system