KEGG   Drosophila yakuba: Dyak_GE13492Help
Entry
Dyak_GE13492      CDS       T01068                                 

Definition
GE13492 gene product from transcript GE13492-RA
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
dya  Drosophila yakuba
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dya00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dyak_GE13492
Enzymes [BR:dya01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dyak_GE13492
Exosome [BR:dya04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Dyak_GE13492
  Exosomal proteins of colorectal cancer cells
   Dyak_GE13492
  Exosomal proteins of bladder cancer cells
   Dyak_GE13492
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 489 aa AA seqDB search
MMWRLAGVLLLGFIAISSGAEQDVLELGDDDFATTLKQHETTLVMFYAPWCGHCKRLKPE
YAKAAELVKDDDPPIKLAKVDCTEAGKETCSKYSVSGYPTLKIFREDEVSQDYNGPREAS
GIAKYMRAQVGPASKTVRSIAELTKFLDTKDTTLFGYFSDIDSKLAKVFLKFADKNREKY
RFGHSSEKEVLDKQGETDKIVLIRAPHLSNKFESSSIKFEASSESELTTFVKENFHGLVG
HRTQDSVKDFQNPLITAYYSVDYQKNPKGTNYWRNRVLKVAKEFVGQINFAIASKDDFQH
ELNEYGYDFVGDKPVVLARDEKNLKYALKDEFSVENLQDFVEKLLANELEPYIKSEAIPE
SNDAPVKVAVAKNFDDLVINNGKDTLIEFYAPWCGHCKKLTPIYEELAEKLQDEDVAIVK
MDATANDVPPEFNVRGFPTLFWLPKDSKNKPVSYNGGREVDDFLKYIAKEATTELKGFDR
SGKPKKTEL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgatgtggcgcctcgctggagtgctcctactgggcttcatcgccatctcatccggagcg
gagcaggatgtcctggaattgggggacgacgacttcgccaccaccctgaaacaacatgag
acgacgctggttatgttctacgccccttggtgcggccactgcaagcgattgaagcccgag
tacgcgaaggcggcagagctcgttaaagacgatgatccgccaatcaaactggccaaggtt
gactgcacggaagctggaaaggaaacctgtagcaagtactcggtcagcggctacccaacg
ctgaaaatcttccgtgaggatgaggtgtcacaggactacaatggaccgcgtgaagctagc
ggcattgccaagtacatgcgcgcccaggtgggacccgcttccaagaccgtgcgctccatt
gccgagctgaccaagttcctggacactaaggacaccacgctgttcggctacttcagcgat
atcgactccaagttggccaaggttttcctgaagttcgccgacaagaaccgcgagaagtac
cgcttcggacattccagcgaaaaggaagtcctcgataagcagggcgaaaccgacaagatt
gtgctgattcgtgccccccacttgagcaacaagttcgagtcttcttccattaagttcgag
gctagctccgagtccgaattgactacctttgtcaaggagaacttccatggccttgtggga
caccgcactcaggattcggtcaaggacttccagaaccccttgattactgcttactacagc
gtggactaccagaagaaccccaagggaaccaactactggcgcaaccgtgtgctcaaggtg
gccaaggaatttgtgggtcaaatcaatttcgcgatcgcctccaaggatgacttccaacac
gagttgaacgagtacggctacgattttgttggcgacaagccagtagttttggctcgtgat
gaaaagaatctcaaatacgccctgaaggacgagttctcagtggagaatctgcaggacttt
gtcgagaagctgctggcgaatgagctggagccatacattaaaagtgaagctattcccgag
tcaaacgacgctcccgtgaaggtggccgttgccaagaacttcgatgatctggttatcaac
aacggcaaggacacgctgattgagttctatgccccatggtgcggtcactgcaagaaactg
actcccatctacgaggagctggccgagaagctgcaagacgaagatgttgccatcgtcaag
atggacgccaccgctaacgacgtgccgccggagttcaacgtgcgcggcttccccaccctc
ttctggctgcccaaggactcaaagaacaagccagtgagctacaacggaggtcgcgaggta
gatgacttcctgaagtacatcgccaaggaggcgaccacagaactgaagggcttcgaccgc
agcggcaagcccaagaagaccgagctctaa

DBGET integrated database retrieval system