KEGG   Drosophila yakuba: Dyak_GE13690Help
Entry
Dyak_GE13690      CDS       T01068                                 

Definition
GE13690 gene product from transcript GE13690-RA
Orthology
K14298  
mRNA export factor
Organism
dya  Drosophila yakuba
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dya00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dyak_GE13690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 346 aa AA seqDB search
MFGATQSTNRMNDFEVASPPDDSVSALEFSPSTVQKNFLVAGSWDSTVRCWEVEQNGATV
PKSMKTMGGPVLDVCWSDDGSKVFVASCDKQVKLWDLASDQVMQVAAHDGPVKTCHMVKG
PTYTCLMTGSWDKTLKFWDTRSPNPMMTINLPERCYCADVEYPMAVVGTANRGLIIYSLQ
NSPTEYKRQESPLKYQHRAISIFRDKKKEPTGCALGSIEGRVAIQYVNPANPKDNFTFKC
HRSTGTTGFQDIYAVNDIAFHPVHGTLVTVGSDGTFSFWDKDARTKLKSSETMDQSITKC
GFNANGQIFAYAVGYDWSKGHEYFNPAKKPQIFLRSCYDELKPRIN
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtttggggccacacaatcgacaaaccggatgaacgacttcgaggtggcctcgccgccg
gacgactccgtctcggcgctggagttcagccccagtacggtgcagaagaacttcctggtg
gccggaagctgggacagcaccgtccgctgctgggaagtggagcaaaacggggccaccgtg
cccaaatcgatgaagactatgggcggaccggtgctggacgtttgctggtcggacgacggc
agcaaggtgttcgtcgcctcctgcgacaagcaggtgaagctctgggacttggcctctgac
caagtgatgcaagtggcggcgcacgatggtcccgtgaagacgtgccacatggtcaagggt
cccacatacacttgcctgatgaccggctcttgggacaagaccctaaagttctgggacacc
cgttcgcccaatcccatgatgaccatcaatctacccgagcgttgctactgcgccgatgtg
gagtatccgatggccgtggtgggcacagccaaccgaggactcattatatactcgctgcaa
aacagccccaccgagtacaagcggcaggagagtccgctgaagtaccagcatcgtgccatt
tccattttcagggacaagaagaaggagcccactggctgtgcgctgggcagcattgagggt
cgtgtggccatccagtatgtgaatccggcgaatcccaaagataactttaccttcaagtgc
caccgctctacgggcaccacaggcttccaggacatttatgccgtaaatgacatcgcattc
cacccggtgcacggcaccctggtcaccgtcggttcggatggcaccttcagtttctgggac
aaagatgcccgcaccaagctgaagtccagcgagaccatggatcagtccattaccaaatgc
ggatttaacgccaacggccagatctttgcgtacgccgtgggctacgactggtcgaagggc
cacgagtacttcaacccggccaagaagccccaaatcttcctgcgctcgtgctacgacgag
cttaagccgcgcatcaactga

DBGET integrated database retrieval system