KEGG   Drosophila yakuba: Dyak_GE13862Help
Entry
Dyak_GE13862      CDS       T01068                                 

Definition
GE13862 gene product from transcript GE13862-RA
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dya  Drosophila yakuba
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Dyak_GE13862
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Dyak_GE13862
Enzymes [BR:dya01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Dyak_GE13862
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 193 aa AA seqDB search
MFDKETIFPGLMAAVALVAVLQTRSRLQQDLQNMRWRLTIHALTVRDTFGRPVQLDKFAG
QVMLIVNIASKCGLTSTQYNGLRYLLEEYEDRGLRILNFPCNQFGAQMPESDGQEMLDHL
RREGANIGQLFAKIDVKGAQADPLYKLLTRHQHDIEWNFVKFLVDRRGNIYKRYGAELEP
VALTDDIELLLGR
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgttcgataaagaaactattttccctggccttatggctgcagtggccctggtggcagta
ctgcaaacacgcagcagattgcaacaggatttgcagaatatgcgatggcgactgacgata
catgcgctcaccgttcgcgatacctttgggagaccagtgcaactcgataaattcgccggc
caggtgatgctcatcgtcaacattgcctccaaatgcggacttacttcaacacagtacaac
ggtttgcgatatttactggaggaatacgaggaccgcggtctgagaattctcaactttccc
tgtaaccaatttggcgctcaaatgcccgagtccgatggccaggagatgttggatcacctg
cgcagggagggagccaacataggacagctcttcgccaagatagatgtgaagggagctcag
gcagatccgctgtacaagctactaacgcgccatcaacatgatatcgagtggaattttgtc
aagtttctggtggatcgaaggggaaacatttacaaaagatatggcgccgaactggaacca
gttgccctcaccgatgacatagagctcctgctcggcagatga

DBGET integrated database retrieval system