KEGG   Drosophila yakuba: Dyak_GE14068Help
Entry
Dyak_GE14068      CDS       T01068                                 

Definition
GE14068 gene product from transcript GE14068-RA
Orthology
K01189  
alpha-galactosidase [EC:3.2.1.22]
Organism
dya  Drosophila yakuba
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Lysosome
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dyak_GE14068
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dyak_GE14068
   00600 Sphingolipid metabolism
    Dyak_GE14068
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    Dyak_GE14068
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dyak_GE14068
Enzymes [BR:dya01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Dyak_GE14068
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 417 aa AA seqDB search
MYGTWGVFLGGILLLQVLQLSMGLDNGLALKPPMGWMSWERFRCITDCKLYPDECISEKL
FQRHADLLVSEGYADAGYEYVIIDDCWLEKNRDNDTQKLVPDRKRFPNGLNALSDHIHNQ
GLKFGLYQDYGTNTCAGYPGVIKHMKLDAQTFADWDVDYVKLDGCYANISDMATGYPEFG
RLLNETGRPMVYSCSWPAYQEDAGEMPDYESLKQHCNLWRNWDDIDDSLESLMQIMDYFA
KNQDRIQPHGGPGHWNDPDMLLLGNYGLSYDQSKLQMAIWSIMAAPLIMSNDLAAVRPEI
KDILQNRAVIAVDQDELGIQGRRVLSRNQIEVWKRPITPVTKNGHHSYAVAFVSRRDDGA
PYRIPFTGKELGLMNPKGYSVQDLFDASNKLGVFQSNSQFITRVNPNGVTFYKFTAL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtacggaacatggggcgtctttctgggcgggatcctcctgctgcaggttctgcaatta
tccatgggcctcgataatggcctggcactcaagccacctatgggctggatgtcctgggag
cgtttccgctgcattaccgactgtaagctatatccagatgagtgcatcagtgagaaactt
ttccagcggcatgcggatctcctggtatctgaaggatatgcagatgctggctacgagtac
gtcatcatagatgactgctggctggagaagaatcgcgacaacgatacccagaagctggtg
ccggacagaaaacgctttcccaacggcctaaatgccttatccgatcatatccacaaccag
ggtctgaagtttggcttgtaccaggactacggcaccaacacctgcgctggctatcccgga
gtgatcaagcacatgaagctggacgcccagacctttgccgattgggatgtggactatgtc
aagctggacggctgctatgccaatatcagcgacatggccacgggttatccggagtttgga
cgcctgctgaatgaaactggtcgtccgatggtgtactcctgcagttggcccgcgtatcag
gaggatgctggagaaatgcccgactatgagtcactcaagcagcactgcaatctgtggcgc
aactgggacgatatcgacgactccctcgagtccctaatgcagatcatggactactttgcc
aagaatcaggacaggattcagccacatggcggaccaggacattggaacgatcccgatatg
ctgctgctgggaaactacggcttgagttacgatcaaagcaagctgcagatggccatttgg
tcaattatggccgcgcctcttatcatgtccaatgatctggctgcagtgcgtcccgagatc
aaggacattctgcagaatcgtgcggttattgctgtggaccaggatgagctgggcatccag
ggccgtcgtgttttgtcccgaaaccaaatcgaagtctggaaacgtcccattacgccagta
accaagaatggacatcactcctatgccgtcgccttcgtcagccgccgagacgatggcgct
ccctacaggatccccttcacgggcaaggagctcggtctgatgaatcccaagggctatagt
gtgcaggatctgttcgatgccagcaataagttgggcgtcttccagtcgaacagtcagttc
atcacacgcgtcaatccaaatggcgtaactttctacaagtttacagcgttgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system