KEGG   Drosophila yakuba: Dyak_GE14091Help
Entry
Dyak_GE14091      CDS       T01068                                 

Definition
GE14091 gene product from transcript GE14091-RA
Orthology
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
dya  Drosophila yakuba
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 471 aa AA seqDB search
MNAAGGGSGSQAAGAAGVNSSLSHNALLSTASGATTMPMAQLADGWLELESDPGLFTLLL
KDFGCHDVQVEEVYDLQKPIESPYGFIFLFRWIEERRARRKIVETTAEIFVKDEEAISSI
FFAQQVVPNSCATHALLSVLLNCNENNLQLGDTLSRLKAHTKGMSPENKGLAIGNTPELA
CAHNSHAMPQARRRLERTGAGVSSCRFTGEAFHFVSFVPINGQLFELDGLKPYPMNHGGW
EDSEDWTDKFRRVMAERLGIATGEQDIRFNLMAVVPDRRIAITHKLKMLRTNQAIVSGTL
QKLLKADEQGESGNGDSQRPDTPTTLLEPSAFTARDLQSLLKNLDTEIAINEQHLADEND
RRHMFKVDASRRTHNYDKFICTFLSMLAHQGVLGELVSQHLLPSKKVSGQGAANRISKQS
TTASAGGSTTGATASTPKTQQQQAAAAKNGKSPSKTPGRRRKGRNKCRKRK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctgctggaggaggtagtggctcccaggcggccggagcggcgggagtcaacagc
agtctcagccacaatgcgctgctatccacggcatcaggagccaccaccatgcctatggca
cagctggcagatggttggttggaactggagtccgacccaggtctcttcaccctgttgctc
aaggattttggatgtcacgatgtacaggtggaggaggtgtacgacctacaaaaacccatc
gagagtccctatggtttcatatttctctttcgctggatcgaagagcggcgtgccagacgc
aaaattgtggagaccactgctgagatattcgtgaaggacgaggaggccatttccagcata
ttcttcgcacagcaggtagtgcccaatagctgtgccacacacgccttgctctcggtgctc
ttgaactgcaacgagaacaatctccagctgggcgacaccctcagtcgactgaaagcccac
accaaaggcatgagtccggagaacaaaggtttggctattggaaacactccggagctggct
tgtgcccacaactcgcacgcaatgccgcaggcccggcgccggctagaacggactggagct
ggtgtctccagctgccgcttcaccggtgaggcgtttcacttcgttagttttgtgcctatc
aatggacaactgtttgagctggatggtctgaagccgtatcccatgaatcacggcggttgg
gaggatagcgaggattggacagacaagttccgacgtgtgatggcggagcgactgggaata
gctactggcgaacaggacatacgctttaatcttatggccgtagtgccggacaggcggatt
gccataacacataaacttaagatgctgcgcacaaaccaggcaatcgtgtccggtacactg
cagaaacttctaaaggctgacgaacagggcgaatcggggaacggagattcacaacgtccg
gatacacccaccacgttattagagccaagcgctttcactgcacgggatctgcaatcgctt
ctcaagaacctggacacagaaatagccatcaatgaacagcacctggccgacgaaaacgat
cggaggcatatgtttaaggtggatgccagtcgacgcacccataactacgacaagttcatc
tgcacgttcctctctatgctggcgcaccagggagtcctgggcgagctggttagccagcat
ctacttccctcgaagaaggtcagtggccagggcgcggccaatcggatcagcaagcagagc
accaccgcgagtgcgggcggaagcaccacaggagccactgcatccacgcctaagactcag
caacagcaggctgcggccgctaagaatggcaaatcaccaagcaaaacgccgggcaggagg
cgaaagggacgcaacaagtgcagaaaacggaaatag

DBGET integrated database retrieval system