KEGG   Drosophila yakuba: Dyak_GE14132Help
Entry
Dyak_GE14132      CDS       T01068                                 

Definition
GE14132 gene product from transcript GE14132-RA
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
dya  Drosophila yakuba
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:dya00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:dya00330]
Metabolism; Metabolism of other amino acids; D-Arginine and D-ornithine metabolism [PATH:dya00472]
Metabolism; Biosynthesis of other secondary metabolites; Penicillin and cephalosporin biosynthesis
Cellular Processes; Transport and catabolism; Peroxisome [PATH:dya04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 341 aa AA seqDB search
MPNIAVIGAGVNGVASAIKILEHFVNEGQTPIRLTIISEDFTPNTTGDGSAGLWGPYLLG
GTSQSKVYKWSKSMHQFLEQIWLSDDAGEAGVCLLPCIRLSTSTVDTVEDFWRDIVYGAV
DLSKEQLAAYNKDRSVKFTSGLSFVTYTSEPIKLLPYLMKRFVRNGGVVVRKRITDLEAF
VADSEYDVIVNCSGLGSRTLLNDEQMYAVRGQVSRVKANWIFSSVLDESDDGNYIIPNTE
SVVLGGTHQERDYNTQVCQKDRRMIVNGCRRYIPGLEHTECLFDWVGLRPGRSQLRLEAE
RRGRKLLIHNYGHGGSGVTLCWGCADDVLDILLAAKNGSKL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgccgaacattgcagttatcggtgcgggggtaaatggtgttgccagtgccattaagata
ctggagcacttcgtgaacgagggacagacaccgataaggcttacaattatatcggaggac
ttcacgccgaacaccacaggagatggttcggcgggtctctggggtccctaccttctcggc
ggcacttcacagtcgaaagtctacaagtggtcgaagagcatgcaccagtttctggagcag
atctggctgagcgacgatgccggagaggctggcgtctgtctgctgccctgcattcggctg
agcacctcgacggtggacacggttgaggatttctggcgcgacattgtctatggagccgtg
gatttgtccaaggaacaactggctgcatacaacaaagatcgcagcgttaagttcacgtca
ggcttatccttcgttacctacacctcggagcccattaagctactgccgtacttgatgaag
cgctttgtccgcaacggaggtgtagttgtccgtaaaaggataacggacctggaggcattt
gtcgccgactccgagtacgatgtgatagtcaattgctctggattaggatccaggactcta
ctgaacgacgagcaaatgtacgcagtacgtggccaagtgtcccgggtgaaggcgaactgg
attttctcgtccgtgctggacgagagtgatgatggcaactacataatacccaataccgag
agcgttgtccttggcggaacgcatcaggagcgggactacaacacacaggtctgccagaag
gacaggcggatgattgtgaatggctgccggcggtacattccgggtctggagcacacggag
tgccttttcgactgggtgggtctacgaccaggtcgcagccaactcaggctggaagccgag
cgccgtgggcggaaactgctcatacacaactatggacatggcggcagtggagtcactttg
tgctggggctgtgcggatgatgttctcgatatcctgttggccgccaagaacggctccaaa
ctatga

DBGET integrated database retrieval system