KEGG   Drosophila yakuba: Dyak_GE14213Help
Entry
Dyak_GE14213      CDS       T01068                                 

Gene name
Dyak_Amy-p, Amy, Amy-p, GE14213, dyak_GLEANR_14353
Definition
(RefSeq) Amylase proximal
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
dya  Drosophila yakuba
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dyak_GE14213 (Dyak_Amy-p)
Enzymes [BR:dya01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Dyak_GE14213 (Dyak_Amy-p)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 498 aa AA seqDB search
MFLAKSIVCLALLAVANAQFDTNYASGRSGMVHLFEWKWDDIAAECENFLGPNGFAGVQV
SPVNENAVKDSRPWWERYQPISYKLETRSGNEQQFASMVKRCNAVGVRTYVDVVFNHMAA
DGGTYGTGGSTASPSTKSFPGVPYSSLDFNPTCSINNYNDANQVRNCELVGLRDLNQGNS
YVQDKVVEFLDHLIDLGVAGFRVDAAKHMWPADLAVIYGRLKTLNTDHGFNSGSKAYIVQ
EVIDMGGEAISKSEYTGPGTLPGRVTEFRHSDSIGKVFRGKDQLQYLTNWGTAWGFAASD
RSLVFVDNHDNQRGHGAGGADVLTYKVPKQYKMASAFMLAHPFGTPRVMSSFSFSDTDQG
PPTTDGHNIASPVFNSDNSCSGGWVCEHRWRQIYNMVAFRNAVGSDAIQNWWDNGSNQIA
FSRGSRGFVAFNNDNYDLNSSLQTGLPAGTYCDVISGSKSGSSCTGKTVSVGSDGRASIY
LGSSEDDGVLAIHVNAKL
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgtttctggccaagagcatagtgtgcctcgcccttttggcggtggccaacgcccaattc
gacaccaactacgcctccggtcgcagtggaatggtccacctcttcgagtggaagtgggac
gacatcgccgccgagtgcgagaacttcctgggacccaatggcttcgccggcgtccaggtc
tcccccgtgaacgagaacgccgtcaaggacagccgcccctggtgggagcgctaccagccc
atttcctacaagctggagacccgctccggaaacgagcagcagttcgccagcatggtgaag
cgatgcaacgccgtcggagtgcgcacctacgtggacgtggtcttcaaccacatggccgcc
gacggaggcacctacggaacgggcggcagcaccgccagccccagcaccaagagcttcccc
ggagtgccctactcctcgctggacttcaacccgacctgctccatcaacaactacaacgac
gccaaccaggtgcgcaactgcgagctggtcggtctgcgcgacctcaaccagggcaactcc
tacgtgcaggacaaggtggtcgagttcctggaccatctgattgacctcggcgtggccgga
ttccgcgtggacgccgccaagcacatgtggcccgccgacctggccgtcatctatggccgc
ctcaagaccctgaacaccgaccacggcttcaactccggatccaaggcctacatcgtgcag
gaggtcatcgacatgggtggcgaggccatcagcaagtccgagtacaccgggcctggtaca
ctgcctgggcgcgtcaccgagttccgccactccgactccatcggcaaggtgttccgcggc
aaggaccagctgcagtacctgaccaactggggcaccgcctggggcttcgccgcctccgac
cgctccctggtcttcgtcgacaaccacgacaaccagcgcggacacggagcaggaggcgcc
gacgtgctgacctacaaggtgcccaagcagtacaagatggcctccgccttcatgctggcg
caccccttcggcactccccgcgtgatgtcctccttctccttctcggacacggaccagggc
ccgcccaccaccgacggccacaacatcgcctcgcccgtcttcaatagcgacaactcctgc
agcggcggctgggtgtgcgagcaccgctggcgccagatctacaacatggtggccttccgg
aacgccgtgggctcggacgcgatccagaactggtgggacaacggcagcaaccagatcgcc
ttcagccgcggcagccgcggcttcgtggccttcaacaacgacaactacgacctgaacagc
tccctgcagacgggcctgcccgccggcacctactgcgacgtcatctccggctccaagagc
ggctcctcctgcacgggcaagaccgtcagcgtcggatccgacggacgggcttccatctac
ctgggcagctccgaggacgacggagtgctggccatccacgtcaacgccaagttgtaa

DBGET integrated database retrieval system