KEGG   Drosophila yakuba: Dyak_GE14257Help
Entry
Dyak_GE14257      CDS       T01068                                 

Definition
GE14257 gene product from transcript GE14257-RA
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
dya  Drosophila yakuba
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dyak_GE14257
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Dyak_GE14257
Enzymes [BR:dya01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     Dyak_GE14257
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 683 aa AA seqDB search
MADKKNLLLLFEHPTEPVFMDKGGNGTLFDVPASYVTERYSKMCRNVQRRVSGGFEKCVL
VKEIEIPDLSCPMRLGRSEQFSHFLKSHRQMASSLIDVFIKMPTVDELQSVAVYARDRVN
PVLFNYALSVAMLHRPDTKDLGLPTFAEIFPDHFIDSQMIRNMREESFVVEQTAARLPVV
NSVKYTASDFDVEHRLWYFREDLGVNLHHWHWHLVYPIDAPDRSIVDKDRRGELFYYMHQ
QIVARYNAERLSNHMARVQPFNNLDEPIAEGYFPKMDSMVASRAYPPRFDNTRLSDVDRP
NNQLRVGIDDMKRWRERIYEAIHQGYVFDDNNEKIALDDVKGIDILGNIIEASALTPNST
LYGDLHNKGHMLIAYSHDPINKHLEYAGVMGDSSTAMRDPIFYKWHAFIDNIFQEHKRQL
TPYEKKDLSFPDVRVQSIEVESQGKINRLTTFWQESDVDMSRGLDFVPRGHVLARFTHLQ
HHPFSYTIKVENSSEATQYGYVRIFIAPKMDDRNNPMPLEEQRLMMVEMDKFVVTMPPGS
QTITRNSTESSVTIPFERTFRNLDQLEELENFMCGCGWPQHMLIPKGRAEGLSFELFVMV
SNYEDDKVEQKAADCACSIAASYCGLRDRLYPDRKSMGYPFDRSIRRGSEMLDRFLTPNM
RAVEVIITHESRTEKLPELPARS
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atggccgacaagaagaatctcctcctgctgttcgagcatcccacggagcccgtcttcatg
gacaagggcggcaacggcaccttgttcgatgtgcccgcctcctacgtgaccgagcgctac
agcaagatgtgcagaaacgtccagcggcgcgttagcggtgggttcgagaagtgcgtcctg
gtcaaggagatcgagatcccagatctcagctgccccatgagactgggccgttcggagcag
ttctcgcacttcctgaagtcccaccgccagatggccagctctttgatcgatgtcttcatc
aaaatgcccaccgtagatgaactgcagagcgtggcggtgtacgccagagatcgtgtcaat
ccggtgctcttcaactacgccttgtcggtggccatgctccatcgtccggacaccaaggac
ctgggtctgcccaccttcgcggagatcttcccagatcacttcatcgactcgcagatgatt
cgcaatatgcgcgaggagtcctttgtggtggagcagaccgctgcccgcctgcccgtcgtt
aattcggtcaagtataccgcctctgacttcgacgtggagcaccggctgtggtacttccgc
gaggacttgggcgtcaacctgcaccactggcactggcatctggtctatcccatagatgcc
cccgaccgcagcatcgtggacaaggaccgccgtggcgagctgttctactacatgcaccag
cagatcgttgcccgctacaatgccgagcggctgagcaaccacatggcccgggtgcagccg
ttcaacaacctagacgagcccattgccgagggctacttccccaagatggactccatggtg
gccagcagggcgtatcctccgcgcttcgacaacacccggctgagcgacgtagatcgcccc
aacaaccagttgagagtgggaatcgacgacatgaagcgatggcgcgagcgcatctacgag
gccatccaccagggctacgtttttgatgataacaatgaaaagattgccctggatgacgtg
aaggggatcgacatcctgggcaacatcatagaggcctccgcattgacgcccaacagtact
ctgtacggcgacttgcacaacaaggggcacatgctgattgcgtactcccacgacccaatc
aacaagcacctggagtatgcgggcgtgatgggcgactcctccaccgcgatgcgcgatccg
atcttctacaagtggcacgccttcatagacaacattttccaggagcacaagcgtcagctt
accccctatgagaagaaggacctaagctttccggacgtgcgcgtccagagtattgaagtg
gagagccagggtaagatcaacaggctgaccacattctggcaggagtccgatgtggacatg
tcccgcggccttgatttcgtgccgcgcggccacgtcctcgctcggttcacccatctgcag
caccacccattcagctacaccatcaaggtggagaactccagcgaggccacgcagtatgga
tacgtgcgcatcttcattgcgcccaagatggatgatcgtaacaatcccatgccgctggag
gagcagcgtctgatgatggtggagatggacaagttcgttgttaccatgccacccggaagc
caaactattacccggaactccacggagtcgagtgtcaccattccgtttgagcgcaccttc
cggaacctggaccagctggaggagctggagaatttcatgtgcggctgcggctggccccag
cacatgttgattccgaaaggtcgggccgagggtctgagtttcgagctcttcgtcatggtt
tccaactacgaagacgataaggtggaacagaaggcagcggattgtgcctgcagcattgcc
gcttcctactgcggactgcgcgatcgcctctatccggaccgcaagtccatgggctatccc
ttcgatcgcagcatccgccggggttctgagatgttggataggttccttacgcccaacatg
cgcgccgtcgaggtcatcattacccatgagtcccgtaccgaaaagcttcccgagttgccg
gcccgctcctga

DBGET integrated database retrieval system