KEGG   Drosophila yakuba: Dyak_GE14437Help
Entry
Dyak_GE14437      CDS       T01068                                 

Definition
GE14437 gene product from transcript GE14437-RA
Orthology
K11852  
ubiquitin carboxyl-terminal hydrolase 31 [EC:3.4.19.12]
Organism
dya  Drosophila yakuba
Brite
Enzymes [BR:dya01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dyak_GE14437
Peptidases [BR:dya01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dyak_GE14437
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 1286 aa AA seqDB search
MGTTKERREQSEGDAATTHSITTTTTAAATVAGGVTTTPATKAATTAAADTSTPNAAKKI
RRTFSMPRNPFRWTRKFKTAAAVTSSSGAEKDNGSGKDNGGGARERRGSHTAISSCVGGG
RGRSGSIVSLSSYEAPFTSSTSNHNNTANNNTTTASNGNNSNTNTNSSSNNNSKRTRALR
RSSFRKFLNRIAQHLSSTVNVVSEEQHSPANRIAFIEIVPFYTGCWRRKEANKHGQPSGP
AVSAGGGGGGGGPGGGERVPPIGGYQWPADQTPGVMGLKNHGNTCFMNAVLQCLSHTDIL
AEYFVLDQYKADLKRRNKINSRKFGTKGELTEQLANVLKALWTCKNESDHSTSFKAVVDR
YGTQFRSSTQHDAQEFLFWLLDKVHEDLNTASKRRYKSLKNSYGRSDEVIAAETLANHIR
CNNSFVQAVFQAQFRSSLTCPRCEKQSNTFDPFHCISVQLPQLTQQTIFVTVVYMKQLPR
QVRMGLRVPAGSPIVALREQLQADTGIEGSRMVLVDLNAEGFTRVFYDTQPVETLSSIET
IYCIEVPEATPVPKAATPPETGDKAAPTAAAPAPAAAQSQADLLLLVANVYRAKDGADIS
RFGAPFSMKAPRDCSYQDLQKRMLREMAPLLKPEVFSYATPLNEMFRIRLQDPSADPDTY
LEQVEHPLLTEMIDMALSVLSSEAGPQHIKLLLEWSSPEAHFISKQQDTEEAVVEHESVA
RLSASKPSDTASLTLEQCLEHYTKAETLSAEDAWRCPHCQQYLPVVKTLGLWSLPDILVV
HFKRFRQHQSKGPQAAKLTTMVKFPLTAFDMSPHLARGVHESASSSLGVGTGLGLGLGLG
SNPWKKARSGDSRSSTLNSRSDAKDTRYDLYAVCYHQGDTLETGHYTAACKNPYDRQWYK
FDDQRVSKVPEDDIEQDIINNEAYMLFYQRRSVDAGECSGSSSNSGDHWVSRIAPAPSSS
ASSTSGKEKEPLKLEESTETPAAASAEKAQSKPVDIPIICQEKAKVTEECPDAVEEKTSV
TRDLHIEELAYADADVDTSLSETSKAEANPAAKDEPKKVEVEVEEATPIFAMDEDCPEPS
LEKKEESVKKEDELSEAPDVSEPTAEPKTNGHVSSSSSSSSSESSLSSRSSPRSLSTSVT
AASTLQSKFNGHMSAAPALFNGNGNTSQLSSSLQLSRHVLHNHQWHGSRSSVSAVENATH
HQQQQAAASLSLRHSFSTSSNYTETLSSLLRKSANTCSKDTLLFIDQQSHHHTAGLIEDD
DDSYMGRSLWISPVTPHKLITVSPKN
NT seq 3861 nt NT seq  +upstreamnt  +downstreamnt
atgggtacgacaaaggagcgaagagagcagagcgagggcgacgccgccaccacccactca
ataacaacaactacaacggcagcagcaacagtagcaggaggagttactactacgccagct
acaaaagcagcaaccacagcagcagcagatacgagcacgccgaatgccgccaaaaagatt
cgccgcaccttctccatgccacgcaatcccttccgttggacgcgcaagttcaaaacggca
gcggccgttacgtcgtcctcgggagcggaaaaggacaacggaagcggcaaggataacggg
ggcggggccagggagcggcgtggcagccacacggccatctcgtcctgcgtgggcgggggg
cgtggcaggagcgggagcattgtgtccctcagcagctacgaggctcccttcacttcgtcc
accagcaaccacaacaatacggccaacaacaacaccaccaccgccagcaatggaaacaac
agcaacaccaacaccaacagtagtagcaacaacaacagcaagcggacacgtgccctgcgc
cgttcgtccttcaggaagtttctcaaccggatcgcccagcacctgagttcgacggtgaat
gttgtgtcggaggagcagcactcgcctgcgaatcgcatcgccttcattgaaattgtgcca
ttctacaccggatgctggcgcagaaaagaggcgaacaaacatggacagccatcgggcccg
gcagtttcggcgggcggcggaggaggaggaggaggaccaggtggcggcgagcgagtgccc
cccatcggaggctatcagtggccggcggatcagactccaggtgtaatgggcctgaagaac
cacgggaacacttgctttatgaacgcggtgctgcagtgcctcagtcacacagacatcctg
gccgagtactttgttttggatcagtacaaggctgacctcaagcgacgcaacaagatcaac
tcgcgaaagttcggcaccaagggagagctcaccgagcagctggccaacgtgctgaaggcg
ctgtggacctgcaagaacgagagtgaccacagcaccagctttaaggcagtggtggatcgg
tacggaacgcagttccgcagctcgacgcaacacgatgcccaggagtttctcttttggttg
ctcgacaaggtgcacgaggacctcaacacggccagcaagcggcgctacaagagcctcaag
aactcgtacggccgttcggatgaggtgatcgccgccgagacgctggccaaccacatccgg
tgcaacaacagcttcgtccaggccgtgttccaggcccagttccgctcatcgctcacctgc
ccgcgctgcgaaaagcaatcgaacaccttcgaccccttccactgcatctccgtgcagctg
ccgcagctcacccagcagacgatattcgtcacggtggtctacatgaagcagctcccacgt
caggtgaggatgggcttgcgagtcccagccggatccccgatagtagcgcttcgcgagcag
cttcaggcggacacgggcatcgagggatcgcgaatggtcctggttgacttaaacgccgaa
ggattcacgcgcgttttttacgacacacagcccgtggagacgctatctagcattgaaacc
atttactgcatcgaggtgccggaggcaactcctgttcccaaggctgctactcctccagag
acgggggataaggctgctccaacagcagcggctcctgctcctgctgcagctcaatcgcag
gcggacctgttgctcctagtggccaacgtataccgtgcgaaggatggcgcggacataagc
cgctttggagcccccttcagcatgaaggcacctcgtgactgctcataccaggatctgcag
aaacgaatgctccgcgaaatggcgccgctgctcaagccagaggtgttctcctatgccacg
ccactgaacgagatgttccgcattcggctgcaagatccctccgcagaccctgatacctat
ttggagcaggtggagcacccgctgcttaccgagatgatcgacatggcgctttccgtgctg
tcctccgaggcgggaccccagcatataaagcttcttctggagtggagttcgcccgaggca
cactttatcagtaaacagcaggacacggaagaagccgtcgtggaacacgagagcgttgcg
cgtctgagtgccagcaaaccgagcgacacagcctcgctgactttggagcagtgcctggag
cactacaccaaggcagagactctgagtgccgaggatgcctggcgctgtccacactgccag
caataccttccagtagtgaagacgctgggtctgtggtctcttcccgacatcctggtggtg
catttcaagcgtttccggcaacatcaatctaagggtccgcaagcggccaagctgacaaca
atggtcaaattcccgctgaccgccttcgacatgtcaccacacctggcacgtggcgtgcat
gaaagcgccagtagctcgctgggcgtgggaacgggtctgggacttggactcggtctgggc
tcgaatccctggaagaaggctcgatccggtgactcgcgctcctccacacttaactcgcgc
agcgacgcaaaggacacgcggtacgacctctacgccgtgtgctaccatcagggcgatact
ttggaaacgggccattatacggccgcctgcaagaatccgtacgaccgtcagtggtataag
ttcgacgaccagcgagtgagcaaggtgccggaggacgacattgagcaggacatcatcaat
aacgaggcatacatgctcttctaccagcgacgcagtgtagatgcaggcgagtgttccggc
tccagctcgaactccggagatcactgggtgtcgcgaattgccccagccccatcttcgtcc
gcatcatcgacgtcaggaaaggagaaggagccgctcaagttggaggaaagcaccgaaact
cctgcggcagcatcagcggagaaggcccagtccaagccggtggacatacccataatttgc
caagagaaggcgaaagttactgaagaatgcccagacgctgttgaagaaaagacatcggtt
actcgtgatctacatattgaggaactggcatatgccgatgcagatgtagacaccagttta
agtgagaccagcaaggcggaggcaaatccagccgctaaggatgaaccaaagaaggtggag
gtggaggtagaggaagctacgcctatatttgccatggatgaagattgccccgaacccagc
ctggagaagaaagaggaatccgttaagaaggaagatgaactctccgaagccccagatgta
agcgaaccaaccgccgagcccaagaccaatggccatgtgagctcttcgtccagctcttcc
tcctcggaaagctcgctctcgtcacgctcctcgccgcgatcattgagtacttcagtgaca
gcggcatctactctgcagagcaagttcaacggccacatgagcgccgcaccagctcttttc
aatggaaatggaaacacgtcgcagctctcgtccagcttgcaattatcgcgacatgtgctg
cacaaccatcaatggcacggatctaggagcagtgtgtcagccgtagagaatgccacgcac
catcaacagcagcaggcggcggccagtctaagcctccggcattcgttttccacaagttca
aattacacggagacactatcatccttgctacgcaagtctgcaaacacatgcagcaaggac
acgctgctgtttatcgaccaacagagtcaccatcacacagccggactgatcgaagatgac
gatgattcgtacatgggcaggtccctttggatatcgcccgtaacgccacacaaactcatc
actgtttcgcccaagaattag

DBGET integrated database retrieval system