KEGG   Drosophila yakuba: Dyak_GE14483Help
Entry
Dyak_GE14483      CDS       T01068                                 

Definition
GE14483 gene product from transcript GE14483-RA
Orthology
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
dya  Drosophila yakuba
Brite
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Dyak_GE14483
Protein kinases [BR:dya01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   Dyak_GE14483
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 831 aa AA seqDB search
MVGSQEKKKKNLLEFSGTAAINKISVYTAENNINTTPLENIKISKALSPSTIPMINQNST
HTGIAQTNIEKSNRHLHRGSGLQFFSSSFEPSGMLNDSKDLPSQSSNNIANYPGDVQILP
MFECCEISESIQAVSLPNVTSTSKNTDVPGLYLGTISEKSKSKSEPECEPLVLVKESSVM
ENHTFLFHEQIIMSGQQKCELHEKPKVLVVSPQQVMILYMNKLTPYERTEILTYPQIYFI
GANAKKRPGVYGPNNSEYDNEQGAYIHVPHDHVAYRYEMLKIIGKGSFGQVIKAYDHKTH
EHVALKIVRNEKRFHRQAQEEIRILHHLRRHDKYNTMNIIHMFDYFTFRNHTCITFELLS
INLYELIKKNGFKGFSLQLVRKFAHSLLQCLDALYKNDIIHCDMKPENVLLKQQGRSGIK
VIDFGSSCFENQRIYTYIQSRFYRAPEVILGAKYGRAIDMWSLGCILAELLSGHALFPGE
NESDQLACIIEVLGMPNKNILASSKRSKSFFSPKGYPRYCTVRTMSDGMVVLIGGQSRRG
KQRGPPCSKSLSKALDGCKDPLFLNFIRGCLEWDADKRLTPTEALKHPWLRRRLPRPPSS
SSGCGGVSGLSVSRNETPVTGQNKNSAAEITASSTPATCISLTIKRDKSHSSLRIHHDGV
PETDFKLIKSVSESSNATIEPMMNTDILVESFRKTAVVSPRIPPMHSADSGGMSCLSAVD
VGPSRYYPYMKNNENKRLFSGSLNSSANSLTHLEQAPNLDALGEYSASTTQNLLSKNNGY
ALNSGSMTIDVAQESLVNIASNYALDKSIDIIEKSNGSLNSNKLRVQSKDM
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atggtcggttctcaggaaaaaaaaaaaaaaaatcttttggaattttctggaacagccgcg
ataaacaaaattagcgtatatacagctgaaaataatataaacacaactcctctggaaaac
ataaaaatctcaaaagcactttcaccttctacaattccgatgattaaccaaaattccaca
catactggtattgctcaaactaatatagaaaaatcgaaccgtcatttacaccggggcagt
ggattgcaatttttcagcagtagctttgaaccatcgggaatgcttaatgatagtaaagac
ttgccctcgcagtcatcaaataatattgccaattaccctggagatgttcaaattttaccc
atgttcgaatgctgcgaaatttcggagtctattcaagccgtatcgttgcctaatgtaaca
tcaacttcaaagaacacagatgttcctggcttgtatttgggtacgatttcagaaaagtcc
aaatcaaagtctgaacccgaatgtgaacctctagttttagtcaaagaatcttcagtaatg
gaaaaccacacatttttatttcacgagcaaattattatgtctggccaacaaaaatgcgaa
ttacacgagaaaccaaaggtactggtcgtttcccctcaacaggtcatgattttatatatg
aataaattaacaccctacgaacgaacagaaatactaacttatccgcagatatattttatt
ggcgccaacgcgaagaagcgtccaggggtctatggccccaataattctgagtacgacaat
gaacaaggcgcttacattcatgtaccgcatgatcacgtggcatatcggtatgaaatgcta
aagataatcggaaaaggtagctttggacaggttattaaagcgtatgatcataaaactcac
gagcatgttgccttaaaaatagtgcgcaatgaaaagcggtttcaccgtcaggcccaagag
gaaattcgaattcttcatcatttacgccgtcacgataaatataatactatgaacatcata
cacatgtttgattactttacttttcgcaatcatacctgcataacatttgagctgctcagc
attaatctttacgaattaataaaaaaaaatggatttaagggcttcagtttgcagctggtg
cgaaagtttgcacactctttgctacaatgtttggatgcactttataaaaatgacatcatt
cattgcgatatgaaaccagaaaatgtgctactgaagcaacaaggacgttctggtataaag
gtaattgactttgggtcgtcatgctttgagaaccagcgtatatacacatacatccaatca
cgtttttatcgcgctccagaggtaattttgggggcaaaatatggcagagctatcgacatg
tggtcgttgggttgtattttagcagaactgctttcagggcatgcattgtttcctggtgaa
aacgaaagcgatcagttggcttgcattattgaggttttaggaatgcccaataaaaatata
ctagccagctcgaagaggtcgaaatcgtttttcagtccaaaggggtatcctcgatattgt
actgttcgtaccatgtctgatggaatggtggtcctaatcggcggacagtcccgtcgtggc
aagcaaaggggcccgccatgctcaaaaagtctatctaaagcactggatggatgcaaagat
cccctctttcttaattttatacgtggttgccttgaatgggatgcagacaagcgattaaca
cctactgaggctctaaaacatccatggcttcgccgtcgcttaccgagaccgccaagtagc
tcaagtggctgtggtggggtgagtggtttaagtgttagtaggaacgaaacaccagttaca
ggacaaaataagaactcggcagccgaaataacggcatcatcaacgcctgccacatgtata
tctttaacgattaaaagggataagagtcattccagtcttcgtattcaccatgatggtgtt
ccagaaactgacttcaaacttataaagtccgtttcagaatcatcaaacgcaacaatagaa
cctatgatgaacactgatattctagtagaaagtttcagaaaaactgcagttgtatcacca
cgtataccaccaatgcattctgctgactccgggggaatgagttgtcttagcgctgtggat
gtcgggccatcgagatattatccgtatatgaaaaacaatgaaaataagaggttattctca
ggctcgttaaacagctcggccaactcattgacacatttggaacaagccccaaacttagat
gctttaggagaatactcggcgtcaacaacacaaaacttgctatcgaaaaataatggctac
gcgttaaactcaggttctatgactatagatgttgcacaagagtctttggttaatatagct
agcaattacgcattggataaatctatcgacattattgaaaaatcaaatggttcgcttaat
tcaaataaattaagagtacaatcaaaggatatgtag

DBGET integrated database retrieval system