KEGG   Drosophila yakuba: Dyak_GE14483Help
Entry
Dyak_GE14483      CDS       T01068                                 

Definition
GE14483 gene product from transcript GE14483-RA
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
dya  Drosophila yakuba
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 831 aa AA seqDB search
MVGSQEKKKKNLLEFSGTAAINKISVYTAENNINTTPLENIKISKALSPSTIPMINQNST
HTGIAQTNIEKSNRHLHRGSGLQFFSSSFEPSGMLNDSKDLPSQSSNNIANYPGDVQILP
MFECCEISESIQAVSLPNVTSTSKNTDVPGLYLGTISEKSKSKSEPECEPLVLVKESSVM
ENHTFLFHEQIIMSGQQKCELHEKPKVLVVSPQQVMILYMNKLTPYERTEILTYPQIYFI
GANAKKRPGVYGPNNSEYDNEQGAYIHVPHDHVAYRYEMLKIIGKGSFGQVIKAYDHKTH
EHVALKIVRNEKRFHRQAQEEIRILHHLRRHDKYNTMNIIHMFDYFTFRNHTCITFELLS
INLYELIKKNGFKGFSLQLVRKFAHSLLQCLDALYKNDIIHCDMKPENVLLKQQGRSGIK
VIDFGSSCFENQRIYTYIQSRFYRAPEVILGAKYGRAIDMWSLGCILAELLSGHALFPGE
NESDQLACIIEVLGMPNKNILASSKRSKSFFSPKGYPRYCTVRTMSDGMVVLIGGQSRRG
KQRGPPCSKSLSKALDGCKDPLFLNFIRGCLEWDADKRLTPTEALKHPWLRRRLPRPPSS
SSGCGGVSGLSVSRNETPVTGQNKNSAAEITASSTPATCISLTIKRDKSHSSLRIHHDGV
PETDFKLIKSVSESSNATIEPMMNTDILVESFRKTAVVSPRIPPMHSADSGGMSCLSAVD
VGPSRYYPYMKNNENKRLFSGSLNSSANSLTHLEQAPNLDALGEYSASTTQNLLSKNNGY
ALNSGSMTIDVAQESLVNIASNYALDKSIDIIEKSNGSLNSNKLRVQSKDM
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atggtcggttctcaggaaaaaaaaaaaaaaaatcttttggaattttctggaacagccgcg
ataaacaaaattagcgtatatacagctgaaaataatataaacacaactcctctggaaaac
ataaaaatctcaaaagcactttcaccttctacaattccgatgattaaccaaaattccaca
catactggtattgctcaaactaatatagaaaaatcgaaccgtcatttacaccggggcagt
ggattgcaatttttcagcagtagctttgaaccatcgggaatgcttaatgatagtaaagac
ttgccctcgcagtcatcaaataatattgccaattaccctggagatgttcaaattttaccc
atgttcgaatgctgcgaaatttcggagtctattcaagccgtatcgttgcctaatgtaaca
tcaacttcaaagaacacagatgttcctggcttgtatttgggtacgatttcagaaaagtcc
aaatcaaagtctgaacccgaatgtgaacctctagttttagtcaaagaatcttcagtaatg
gaaaaccacacatttttatttcacgagcaaattattatgtctggccaacaaaaatgcgaa
ttacacgagaaaccaaaggtactggtcgtttcccctcaacaggtcatgattttatatatg
aataaattaacaccctacgaacgaacagaaatactaacttatccgcagatatattttatt
ggcgccaacgcgaagaagcgtccaggggtctatggccccaataattctgagtacgacaat
gaacaaggcgcttacattcatgtaccgcatgatcacgtggcatatcggtatgaaatgcta
aagataatcggaaaaggtagctttggacaggttattaaagcgtatgatcataaaactcac
gagcatgttgccttaaaaatagtgcgcaatgaaaagcggtttcaccgtcaggcccaagag
gaaattcgaattcttcatcatttacgccgtcacgataaatataatactatgaacatcata
cacatgtttgattactttacttttcgcaatcatacctgcataacatttgagctgctcagc
attaatctttacgaattaataaaaaaaaatggatttaagggcttcagtttgcagctggtg
cgaaagtttgcacactctttgctacaatgtttggatgcactttataaaaatgacatcatt
cattgcgatatgaaaccagaaaatgtgctactgaagcaacaaggacgttctggtataaag
gtaattgactttgggtcgtcatgctttgagaaccagcgtatatacacatacatccaatca
cgtttttatcgcgctccagaggtaattttgggggcaaaatatggcagagctatcgacatg
tggtcgttgggttgtattttagcagaactgctttcagggcatgcattgtttcctggtgaa
aacgaaagcgatcagttggcttgcattattgaggttttaggaatgcccaataaaaatata
ctagccagctcgaagaggtcgaaatcgtttttcagtccaaaggggtatcctcgatattgt
actgttcgtaccatgtctgatggaatggtggtcctaatcggcggacagtcccgtcgtggc
aagcaaaggggcccgccatgctcaaaaagtctatctaaagcactggatggatgcaaagat
cccctctttcttaattttatacgtggttgccttgaatgggatgcagacaagcgattaaca
cctactgaggctctaaaacatccatggcttcgccgtcgcttaccgagaccgccaagtagc
tcaagtggctgtggtggggtgagtggtttaagtgttagtaggaacgaaacaccagttaca
ggacaaaataagaactcggcagccgaaataacggcatcatcaacgcctgccacatgtata
tctttaacgattaaaagggataagagtcattccagtcttcgtattcaccatgatggtgtt
ccagaaactgacttcaaacttataaagtccgtttcagaatcatcaaacgcaacaatagaa
cctatgatgaacactgatattctagtagaaagtttcagaaaaactgcagttgtatcacca
cgtataccaccaatgcattctgctgactccgggggaatgagttgtcttagcgctgtggat
gtcgggccatcgagatattatccgtatatgaaaaacaatgaaaataagaggttattctca
ggctcgttaaacagctcggccaactcattgacacatttggaacaagccccaaacttagat
gctttaggagaatactcggcgtcaacaacacaaaacttgctatcgaaaaataatggctac
gcgttaaactcaggttctatgactatagatgttgcacaagagtctttggttaatatagct
agcaattacgcattggataaatctatcgacattattgaaaaatcaaatggttcgcttaat
tcaaataaattaagagtacaatcaaaggatatgtag

DBGET integrated database retrieval system