KEGG   Drosophila yakuba: Dyak_GE14499Help
Entry
Dyak_GE14499      CDS       T01068                                 

Definition
GE14499 gene product from transcript GE14499-RA
Orthology
K15293  
protein unc-13
Organism
dya  Drosophila yakuba
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 3210 aa AA seqDB search
MMNTSQLQATGDTEKKSQLLKKELKINTQEKLIFAENALKSQIKIKEQLRLQQQSTMYAS
SLFNSSSGRLVKAPLLNQRHLNSIQNHINFDLAQKQKLQMQPPMSKSPVGLDSTYFTYPS
TSTNGSMISIKSEQQLCQIYNSQQHSDYIISDYMDKIATRISLLETELKFAWRALDLLST
EYGKIWTRLEKLENISIEQQSVVGNLMDLIGASKPELHQVDIEKMEVPLYQDEDQLLPLI
MEPTLDIDIQPSDHDYDKKLTFENHNNTFVSELTPATESNEFMNAACAIDSHPNFENVAL
NDNSLELGITQFGFEKGYDPNQKGIQSDFEASQKESKIQLYSDSDLMLYERQQFLANSAR
AELMKEFLNGRRVLNEISASSGTLSKSSKKCKDFVQPREPFINNHLLFETDDKYKRQTSS
EHDSLIGDTFFRLAASKTGEGGIQVLPIEDSGGTKIPANINEVDESFYKKLNEAYRDNEL
SSEIFKVDALLHKSGATHDQISSIRNHSAASLLLNNQGVKDITDIQSLQTAKTSVVMQSN
QNLNKESRKHRKKKHHTNEMDMINKLKCILAQAQSTQIIKVDTEELRYSQSTPGDKPTET
EDITMQNESDKQRSSRYLRDDIRKTLNNVIQTLLDEINKITGLQSLSATQISQLRNAVWS
EEKFFQKISQVDKKLTLLLLNPLTVTEELQRLCISNTNEKFVLVMRKLKKNIDTLKKLVG
NSLDDLTIDNSHANTTTSHRLNSSLNSNVSSFSAQLLRNNSNLDEQLKIIETQEIEIHRK
KKIDEIKSAHPEEVDTLNPDIEYKSHNSCINSTDNILSFSKNIYNEDEYIKSLKKSLERH
NSMIFLLHLQNPEKHKVLADINDALIDSNRSSLSPPPPAPTDTINLNEAINQISCQQRNA
KSDSGLSSMSGWSPNSQVSVGIQNYDFVCNNIYKNCSERLPLAENLSLHNLPVSYEQAQT
SIKNEFVILEENLNYIYELSKNLPICSAYENKSIFDMNSDSNEIRKFSTVDEMLEWDQLN
EPDKQNFSAKRVNSNLMPDLLTAQTQKCSLNHNKKTNMKMEYVGQEENGSMTKRSIIAPN
IYNGKSVNQFCRPCLTDRLVFYPSSNSITDSNSSHNLNYLGQQDQTQNNKVFGSAPSNQV
LTNYLDYTPGSYSKGQPEDLIDATNSSQLEFEVESESLFNSPNSSSYFKQQRFVQEPSAT
KPLKVWNRLNTILTQNLTLKRPSKFNRSQSLPGDVQSQGVQRQSRGQAGSCPFLSHKRSN
LGGSQVQLSKRIQKLPMRFMRRATGAPFVRRLSSPESAVSLDSAADKRFSSEKSLQKKSI
SSRMNILMQKAKKYKRHSFVLRRGCNMSDSKLETADFASSDNDKSSISASEILLNQSDEV
EDEREEDFNDKNGCDFDYQSEFGGSIEKLNGNLPDNLFPIVGDIKRVQNPLPLAASTETS
LFKHNNSNEYENLKTLPIAMPKIHLETPAEACHQELKSAQSDDEVVKNSLENSVKNNLNA
PTLSILQTIEDDFVPTMTTFLTTTTTTTTTTINSSRNFNGTSALWVTQQCLDLPNNLGCG
GSREDDDNRSQHSARTLSSSRRQSTEDSIDTDDEYFYYELRQLEEQEKQRAQISALSSSE
RQDDNGVLFSQIGQLLQNDVNGEDCFCPSGVYKDGEEAIIYSPSESVKLRMSDVFIELKS
VVSLVPCIYDDSVVYAASVATIKGTSIVKPTCEKLATVSDMHSAWQDINGELQITASDID
SNDDIISNKDRETVIFLNNKQRKLRRLKKKTRDRKVNTSNNAGSSSSSCHSENECEQYER
NKPLGKCTQRLEADKAENEISHKSEASSETSGPDTPAELSDVEISETENGVRADGPNIDG
MHENSESLLKGNLTSLLHDHNLKNQSLETYHHNTHILKNITSKSLSTQNQIDSKKLISQE
LDADGTQAVGNETGLGSSKWKLLKTLKERKIEEKNNQDKIKEDEMTKDRDKNGGGTGEVG
LRTNGHPGDNPFYSNIDSMPDIRPRRKSIPLVSELTMAATKRNAGLTSAVPRATLNDEDL
KMHVYKKALQALIYPISSTTPHNFLLWTATSPTYCYECEGLLWGIARQGVRCTECSVKCH
EKCKDLLNADCLQRAAEKSSKHGAEDKANSIITAMKDRMKQREREKPEIFELIRMTFGVD
PDTHIDSLEQAEHATVEGTSKWSCKLTITVICAQGLIAKDKSGTSDPYVTVQVSKVKKRT
RTMPQELNPVWNEKFHFECHNSSDRIKVRVWDEDNDLKSKLRQKLTRESDDFLGQTIIEV
RTLSGEMDVWYNLEKRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENLFHYLCE
ENTGMVKLPTQKGDDAWKLYFDEIPEEIVDEFSMRYGIENIYQAMTHFHCLSAKYLCPGV
PAVMSTLLANINAYYAHTTASSAVSASDRFAASNFGKEKFVKLLDQLHNSLRIDLSMYRN
NFPASSPEKLMDLKSTVDLLTSITFFRMKVQELSSPPRASTVVKDCVKACLRSTYQFLFE
NCYELYNREFQVDPNEAKRAPDDHEPKLDSVDFWHKLIALIVSVIDEDKNSYGTVLNQFP
QELNIGQLSASSMWHLFAVDMKYALEEHEQHRLCKSSAYMNLHFRVKWLYSNYVKEVPPY
KGAVPDYPAWFEPFVMQWLNENDDVSLEYLHGAFKRDKKDGFQKSSEHALFSNSVVDVFT
QLTQCFDVVSKLECPDPEIWKRYMRRFAKTIVKVLIAYADIVKVEFPEHMKDERIACILM
NNIQQLRVQLEKMFESMGGDKLEEDAANILKELQQNLNSALDDLASQFAISLEPRITQSV
RELGDMLLSIKGGSGTLAVGNLAAQRNAVAVEADEVLRPLMDLLDGSLTLYAQSCEKTVL
KRLLKELWKIVMRILEKTIVLPPMTDKTMMFKHLTDNAKNLASNAKIEDMGRLFKSHMAG
KQDVKSALSGVMDISKEVEKNLSPKQCAVLDVALDTIKQYFHAGGNGLKKTFLEKSSELQ
SLRYALSLYTQMTDTLIKTFISSQVHEVDPENSEESVGEISVQIDLFSHPGTGEHKVNVK
VVAANDLKWQIPSGMFRPFVDINLIGPHLQEKKRKFATKSKSNNWSPKYNESFSFTIGNE
EQLDFFELHICVKDYCFARDDRLVGVAVIPLKDISEKGSVACWLPLMRRIEMDETGWTIL
RILSQRNNDEVAKEFVKLKSEIRQEPTMGT
NT seq 9633 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacacatctcagctgcaggcgaccggagatacggaaaaaaaaagtcagttactt
aaaaaggaactcaaaataaacacccaggaaaagcttatctttgcagaaaatgctctaaaa
agccagattaaaataaaggagcagttacggcttcagcaacaatcaacgatgtatgcgtcg
tcactatttaactcttcttctggtagattagtaaaagcaccgctcttaaaccagcggcat
cttaattctatccagaaccacattaatttcgacctggcccaaaagcaaaaattgcaaatg
caaccaccgatgagtaagtcgcccgttggattggattcaacatatttcacttatccaagc
acaagtactaatggaagtatgatatcgattaaaagtgaacagcagttgtgtcagatctac
aattcacagcaacactctgactacattatatccgattatatggataaaattgcaacaagg
attagtttacttgaaacagagctaaagtttgcttggcgtgcattggacttgctttctaca
gagtacggaaagatttggactcgtttggagaagcttgaaaacatatcaatagaacagcag
tctgtcgttggtaatcttatggatcttatcggagcatcaaaaccagaactacatcaagtc
gatatcgaaaaaatggaagtacctctatatcaggatgaagatcaattactaccgttgata
atggaacccacattggatatagatatccaaccatctgatcatgactatgataagaaactt
acttttgaaaaccataataacacctttgtaagcgaactaacgccagctactgaatccaat
gagtttatgaatgccgcttgcgcaatagattcccatccaaattttgaaaacgttgcattg
aatgacaatagcttggaacttggaataactcaatttggttttgaaaaaggttatgatcca
aatcagaaaggtattcaatcagatttcgaagcttcacaaaaggaatccaaaattcaactt
tactcagattctgaccttatgttgtatgagaggcagcagtttctagcaaatagcgcccgt
gccgaattaatgaaggaatttttgaatggacgtcgagttttaaatgagatttcggcatcc
tcaggtacattgtctaaaagttctaaaaagtgtaaagattttgtacagccaagagaacca
tttattaataaccacttgcttttcgagacagatgataaatacaagagacagacaagcagt
gaacatgacagccttattggtgatacgttttttcgtttagcagcctctaaaaccggcgag
ggtggaatccaggtactacccattgaagattctggaggaacgaaaattccagctaatatt
aatgaagtggacgaatctttttataaaaaactaaacgaggcatatcgtgacaatgaattg
agctctgagatatttaaggtagatgcattactacataagtctggggccacacacgaccaa
atctcatctatccgtaaccactcagctgcttcccttcttttaaataatcagggtgtgaag
gatattacagatatacaatctttgcagactgcaaaaaccagtgttgtaatgcagtcaaat
caaaacttgaacaaagaatcaagaaagcacagaaaaaaaaaacatcatacaaacgaaatg
gatatgattaataaactaaagtgtatccttgcacaagcacaatcaacacaaattattaag
gtagacacggaagaattgcgttattcacagtcaactccgggtgataaaccaactgaaacg
gaagatattactatgcaaaatgaatcagacaaacagcgtagtagcagatacttaagagat
gatatacggaaaactttgaacaacgtaatacagactttattggatgaaataaataaaatt
acaggcctacaatcattgagtgcaacacaaataagtcagttacgaaacgctgtatggtca
gaagaaaagttttttcaaaaaattagccaagtcgataaaaaattgactttgctcttacta
aatccgttaacagtaacagaagaactacaaagactttgcatttcaaacacaaatgaaaag
tttgtgctggtaatgagaaagttaaaaaaaaatattgatacactaaaaaagttagttggc
aactcattggatgatttgacaatagataattcacatgcaaatacgaccacatctcaccgt
cttaattcatcccttaattctaatgttagtagttttagtgcacaattattaagaaacaac
tctaatctggatgaacagttgaaaattattgaaactcaagagattgaaatacatcggaaa
aagaaaatagacgaaattaagagcgcacaccccgaagaagtcgatactttaaacccagat
attgaatataaaagccataatagttgtattaattcaactgataatattttaagcttttca
aaaaatatttacaatgaagatgaatacataaagtctttaaaaaagagtctggaacgacac
aatagcatgatttttttactccatttgcaaaatcctgaaaaacacaaagtattggctgat
ataaatgatgcactaatagattcaaaccgatccagtctcagtcctccaccaccagctcca
accgatacaattaacttaaatgaggctattaatcaaatttcatgtcaacaacgaaatgca
aaatcggactcgggcctatcgtcgatgagcggctggtcacccaactcccaagtgtcggtt
ggaattcaaaactacgattttgtctgtaataatatttataaaaattgtagcgaaagattg
cctttagctgaaaatttaagccttcacaatttaccagtcagttatgaacaagctcaaaca
agtataaaaaatgagtttgtgatattagaagaaaatctaaactatatttatgagctttct
aaaaatttacctatttgctctgcctatgaaaataagtctattttcgatatgaatagcgac
tcaaatgaaataagaaaattttccactgttgacgaaatgctggaatgggaccagctcaat
gaaccggataaacaaaacttttctgcgaaacgggtaaactctaaccttatgccagatctt
ctgactgcgcaaacacaaaaatgctcattaaatcacaataaaaagacaaatatgaaaatg
gaatatgttgggcaagaagagaatggaagcatgacgaagcgtagcatcatagcaccaaat
atttataacggaaaatcggtaaatcaattctgcagaccttgtttaacagatagactagta
ttttatccctcatcaaactctattaccgattccaatagcagccataatttgaattatttg
ggtcaacaggatcaaacacagaataataaggtattcggatctgcaccttcgaatcaagtt
ctaacgaactatcttgattatactcctggtagttattctaagggccagccggaggatctc
attgacgcaacgaactcaagtcaactggaatttgaggtcgaatcggagtcactgttcaac
tctcctaatagttctagctattttaaacaacaaaggtttgttcaagaaccatctgctaca
aagcctttaaaggtatggaacaggcttaataccatattaacacaaaatctaacgcttaag
cggccgtcaaagtttaatagatcacagtctttacccggtgatgtgcaaagtcaaggcgtt
cagagacagtctcgtggccaggccggctcgtgtccgtttctttcccacaagcgttccaat
ctaggcggaagccaggttcagttatcgaagagaatacaaaagcttcctatgcgttttatg
cgacgagcgacaggagccccattcgtgcggcgcttgtcaagtcctgaatccgctgtttca
ttagattctgctgccgataaacgattctcaagcgaaaaaagtttacaaaaaaaatcaatt
tcgtctaggatgaatattttaatgcaaaaagcaaagaagtacaaacggcacagctttgtc
ctgcgccgcggctgtaacatgtcggattctaaattggagacggcagactttgcttcatcg
gataacgataaaagttcgatatcagcaagtgaaattttgttgaatcaatcggacgaggta
gaagacgaacgagaggaagatttcaatgataaaaatgggtgtgactttgactatcaaagt
gaatttggtggttcaattgagaagttaaatggcaacctaccagataatctatttcctatt
gttggtgacataaaaagggttcaaaaccccttaccactggctgcctcaacagaaacttct
ctttttaagcataataatagtaatgaatatgaaaatcttaaaactttacccatcgcaatg
cccaagattcacttagagacgccagcagaggcatgccatcaagaactgaaatcagcacag
tctgacgatgaagtcgttaagaactcactggaaaactcggtcaaaaataatctaaatgcc
cccacgcttagtatattacagacgattgaagatgatttcgtcccaacgatgactacattc
cttacaacaacaacgacaactacaactacaacgataaacagcagtcgtaatttcaatggc
actagcgctttatgggtcacgcagcagtgcttagaccttccaaacaatctcgggtgtggg
gggtcgcgagaagatgacgataatcgcagtcagcattctgctcgcactctctcttcttct
cgtcgacaaagcactgaagatagcattgatacagacgacgaatacttttattatgagctt
cgccagttagaggagcaggaaaagcaacgggctcaaatttctgcactttcatcttccgaa
cgacaagatgacaatggggtgttgttttcacaaattggacaacttcttcaaaacgatgtt
aacggagaagactgtttttgcccttctggtgtctataaggatggagaagaggctattatt
tattcgccaagtgaaagtgtaaagttacgaatgtctgatgtatttattgaacttaaaagc
gttgttagtttagtcccatgcatatatgatgacagtgtggtatacgcagcgtctgtcgcg
actattaaaggaacttctattgtgaaaccaacatgtgaaaaacttgcaacagtttccgac
atgcacagtgcgtggcaggatattaatggtgaattacaaattacagcttccgatattgat
tctaatgacgacataatttcaaataaggacagggaaactgtaatttttttaaataacaaa
caacgaaaattgagacggttaaaaaaaaaaacacgcgatcgtaaagttaatacatctaac
aatgcaggtagttccagttcctcttgccattctgaaaatgaatgtgagcagtatgaacgt
aataaaccacttggaaaatgtactcagagattggaagcagataaagctgagaatgaaata
tcacataaatcggaagcatctagcgagacatcaggaccagatacgccagcagagctgagc
gatgttgagataagcgaaaccgaaaacggtgtgagagctgacggcccgaatatagatggc
atgcacgaaaattcagagagccttttaaagggtaatctgacgtccctattacatgaccac
aatttaaaaaaccagtctctggaaacatatcaccataatacgcacatattaaagaatatt
acaagtaaatcactttcaacgcagaaccaaattgactcaaaaaagttaattagtcaagaa
ttagatgctgatggaacacaagctgtaggcaatgaaactggtcttggcagtagcaaatgg
aaactgctaaaaactttaaaggagcgcaagatcgaggaaaaaaataatcaagataaaata
aaagaagatgaaatgacaaaggacagggacaagaatggaggtggtactggagaagtggga
ttacgtacgaatggtcatcccggtgataatccattttatagcaacattgacagtatgccg
gacataaggcctcgtagaaaatccattcctctcgtgtctgagctgacaatggccgctaca
aaacgaaatgctggactcacatctgctgttccgcgtgcaacgcttaatgacgaagatctg
aaaatgcacgtgtacaaaaaagctctacaagccctgatctaccctatatcttccacaacg
ccacacaattttttgttatggactgctacgtcaccaacgtactgctacgagtgtgagggt
cttttgtggggaatagcacgacaaggggtgcgatgcactgagtgcagtgtaaagtgtcat
gaaaaatgtaaggacctgctgaatgcggactgcctacagcgtgctgccgaaaaaagctca
aagcacggcgcggaagacaaggctaactccattattacagccatgaaagatcgaatgaag
caacgtgaacgggagaagcctgaaatttttgagttgattaggatgacattcggtgtggat
cccgatacacacatagattcattagagcaggctgagcacgcaactgttgagggaacatct
aagtggtcatgcaaactaaccattacagtgatttgtgctcaaggcctgatagcgaaggat
aaaagcggtaccagtgatccatatgtgacggtgcaggttagcaaggtgaaaaaacgaacg
cgaacaatgccgcaggaacttaatcctgtgtggaacgagaagtttcacttcgaatgccat
aactcttctgatcgcataaaagttcgagtttgggacgaagacaatgacctgaagtcgaag
ctgcgtcagaaattaactagagagtcggacgactttttgggccaaacaattattgaggtt
cgtactctttctggtgagatggatgtatggtacaatctggaaaagcgcacagataaatcg
gccgtgtcaggcgcaatacggcttcacatatctgttgaaataaaaggcgaggaaaaggta
gctccttaccatgtacaatatacctgtctacacgagaacctatttcattatctttgtgaa
gaaaataccggaatggtcaagttgccaacccaaaaaggggacgatgcttggaagttgtat
tttgatgaaatacccgaggaaattgtggacgagttttcaatgcgatatggaattgaaaat
atctatcaagctatgacacatttccattgcttatctgctaaatacctttgtccaggggta
ccagctgtaatgagtaccctgttggcaaacataaatgcttattatgctcatacgactgct
tcctcagctgtatcggccagtgatagatttgctgcaagcaattttgggaaagaaaaattt
gttaagttgctggaccaattgcacaactcactaaggattgatttgtcaatgtacagaaat
aactttcctgcatcgagcccagaaaagttaatggatctaaaatctacagtcgatttattg
accagcataacatttttccgcatgaaggtacaagagctatctagcccgccgagggcaagt
actgtagtcaaggattgtgttaaagcatgcctaagatccacttatcagttcttatttgag
aactgttatgaactctacaatagagaatttcaggtggatcccaatgaagctaagcgtgca
ccagacgatcacgaaccaaagcttgatagcgttgacttctggcacaagcttatagcttta
atcgtatctgtgatagatgaagacaaaaacagttacggaaccgtcttaaatcaatttccc
caagagctaaatattggacagttatcagcctcttcaatgtggcatctctttgctgtggac
atgaagtacgcgctcgaggagcacgagcagcatcgtctatgcaagtcatccgcttatatg
aaccttcactttcgagttaagtggctatacagtaactacgtcaaggaggtgcctccctac
aagggagcggttcccgattatccagcatggtttgagccttttgtgatgcagtggctaaat
gaaaatgacgatgtttcattggaataccttcatggcgcatttaagagggacaaaaaagac
gggtttcaaaagagcagcgagcacgcgcttttttctaattctgtagtcgacgtttttacg
caattgacgcaatgtttcgatgttgttagcaaactcgagtgtcctgatccagaaatttgg
aaacgttacatgaggcgttttgctaaaacaatcgtaaaagtgcttatagcctatgcggat
attgtgaaagtagagtttccagagcatatgaaggatgaaagaatcgcttgcatacttatg
aacaacattcagcaactgagggtgcagttagaaaaaatgtttgagtctatgggtggggat
aagctagaggaggatgccgcgaatattttaaaagaacttcagcaaaatcttaactcagcg
ttggacgacttagcttcacaattcgcaataagtttggagccacgaataactcaatcagtg
cgagaacttggggacatgttgctgtctatcaaaggaggcagtggaactcttgctgttggt
aatcttgcagcccaaagaaacgcggtagccgttgaggctgatgaagttttaaggccgctt
atggatttactcgatggatctttaactctctatgcgcaatcatgcgaaaaaactgtattg
aagagattactaaaggagttatggaagatcgtaatgcgaatattagagaaaacaattgtt
ttaccacctatgactgataaaactatgatgtttaaacacctcactgacaatgcaaaaaac
ttggcatccaatgcaaaaattgaagacatgggtcgtttgttcaagtcacatatggcagga
aagcaggatgttaaaagtgctctgagcggggtaatggacatatcaaaagaagtggaaaaa
aacttgtcacccaagcagtgcgcagtgcttgacgttgccttagatacaataaaacaatat
tttcacgcgggtggcaatggactgaagaagaccttccttgaaaagtcgtctgagcttcag
agtttacgttacgcactcagtttatatacacaaatgaccgacacattaattaaaaccttt
atatccagccaagttcacgaggtcgatccagaaaactcagaagaaagtgtcggcgaaata
tccgtgcaaatagacttattttcccatccaggcaccggtgaacataaagtaaacgtgaaa
gtggttgctgctaatgaccttaaatggcaaataccatcgggtatgttcagaccatttgtt
gacattaatttaatcggaccacacctgcaagaaaaaaaaaggaagtttgctacaaagtcg
aagtctaataactggtcacccaaatacaacgaatcattcagcttcaccattggaaatgag
gagcagttagacttctttgaattgcacatttgcgtcaaggactattgttttgctcgtgat
gatcgacttgtaggcgtggccgtaattccattaaaagatatatcggaaaagggatcggtt
gcatgctggttacctttaatgaggcgtatcgaaatggacgaaacgggttggaccatttta
agaattttgtcgcagcgaaataatgatgaagtggccaaggaatttgtcaagctgaaatcg
gaaatacggcaggagccaaccatgggcacataa

DBGET integrated database retrieval system