KEGG   Drosophila yakuba: Dyak_GE14543Help
Entry
Dyak_GE14543      CDS       T01068                                 

Definition
GE14543 gene product from transcript GE14543-RA
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
dya  Drosophila yakuba
Brite
Enzymes [BR:dya01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dyak_GE14543
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 811 aa AA seqDB search
MALESGSSSSESGSSSTSGSTSSETGSSSDTDSSSATPEEKPSTNSSAKSQTQTQQQTNT
GNAQRKKPASSAAEEKSKPIVAPAARKVNNPPKSKLSSDDDDDEDSAPPAKKNSRAMGSS
TVTAAAASSAARRKPPAPVNKPSNPANKSSNPPQRSANNNTNRSLENGEGKRPSLSSSSN
STDDSMKIVKNGRKVPLKMASTVRPKQIRGKLPPAKKNGGGPVISSDGSSGSESGSNSGD
ESSSGSESEGTDSSNSYSSQPVKGGAKGKRSGPAKMQNSDSEEERKDKANPMRKLTRSLS
MRRTKQQPKQDTDSESDGDLEDDKIMISKSAAKKPAPSNLNATKSKVKREPMGISSGVLS
SIKSRPVSPITQTEKKCPIEGCDSSGHLSGNLDKHFLPEACPIYHNMSASECKERANERK
MRNEQRLKMPVNIVTAPGNQNTNLKTLSPEQREFLAKIRESRANFKPANNNFLDSKVKLE
KDVTDEDREPNLSGLVPDYDLQLFREAQAQASERIEDELKDLPVGKGIKYISMGKYKMKV
WYQSPYPDDAARLPKMYICEFCLRYQKSETGIKRHAEKCVWRHPPGDEIYRKGKLQVWQV
DGKRYKQYCQHLCLLAKFFLDHKTLYYDVEPFLFYIMTLADVDGCHIVGYFSKHIPFLQE
KNSFYNVSCILTLPPYQRKGYGRLLIDFSYLLTRVEGKIGSPEKPLSDLGLISYRSYWKD
VLLDYLCNRSGNTIAIKDVSQETAIYSYDIVSTLQALGMMKYWKGKHIVLKKQDVLDEYE
ERVKRRGTFPKIDDSCLRWQPFINIQPSSSP
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atggccttggagtccggcagcagcagctcggagtcgggcagctcctccaccagcggatcc
accagttcggagacgggcagcagctcggacacggattccagcagtgcgacgccggaggag
aagccatccacgaattcctccgccaaatcccagacgcaaacgcaacaacaaacgaatacc
ggaaatgcacagagaaaaaagcctgcttcttcggcggcggaagagaaatccaagccgatt
gtagcgccagccgccagaaaagtaaacaatcctcccaaaagtaaactctccagcgacgat
gacgatgatgaggattcggcgccgccggccaagaagaactctcgtgccatgggcagttcc
acagtaacagcggcagcagcctcctctgcagccagaaggaaaccacccgcgcccgtcaac
aagcccagcaatccagctaacaaatccagcaatcctccccagcgatcagcaaacaacaac
accaaccgatcactggagaacggcgagggcaaacgaccctcgctctcctcctcgtccaac
agtacggatgactcaatgaagatcgtcaagaacggccgcaaggttcccctcaaaatggcc
agcacggttaggcccaaacaaattcgaggaaaactgccgccggcgaagaaaaacggtgga
ggaccggtgatcagcagtgacggcagttcgggctccgaaagtggttccaactcaggcgat
gaatcaagctctggaagcgaatctgagggaactgattccagcaactcctacagctcgcag
ccagtaaaagggggagctaaaggtaagaggagcggtccagcaaaaatgcaaaactccgac
agcgaagaagagcgtaaagacaaggccaatcccatgaggaaactcacgcgatcacttagc
atgcgaaggacaaagcagcagcccaaacaggacaccgattcggaatccgatggcgaccta
gaagatgacaaaattatgatctcgaaaagtgccgccaaaaagccagcgccctcgaatctg
aacgccaccaaaagtaaggtgaaaagggaacctatgggaatcagcagtggagtcctgagc
tccattaaatcccgacccgtgtcacctattacccagactgaaaagaagtgccccatcgag
ggctgcgattcatccggccacctaagtggcaatttggacaagcactttttgcccgaggcc
tgtcccatctatcacaacatgtccgcctcggaatgcaaagagcgggccaatgagagaaaa
atgaggaacgaacagcgactgaagatgcccgtcaacattgtgacagcgccgggtaaccaa
aacaccaatctcaagactctctcgcccgagcagcgcgagtttctggccaagattcgcgag
tcaagggccaacttcaagccggcgaataataattttttagactcgaaggttaagttggag
aaagacgttacggatgaggaccgggaaccaaatctgtcgggcctggtgcctgactatgat
ttgcaattgttccgagaagcgcaagctcaagcctccgaaaggatagaagacgaactcaag
gacctgcccgtgggaaagggaataaaatatatcagcatgggcaagtacaagatgaaggtc
tggtatcaatccccctatccggacgatgctgcccgcctgcccaaaatgtatatctgcgag
ttctgcctgcgctaccaaaaatcagagacgggcattaagcgacatgccgagaaatgcgtc
tggcggcatccgccgggcgatgagatataccgcaagggcaaactacaggtgtggcaggtg
gacgggaagcgttataagcaatactgtcaacatctgtgcctgctggcaaagttcttcctg
gatcacaaaaccctctactatgatgtggagcccttccttttctacatcatgacgctggcg
gatgtggatggatgccatattgtgggttatttcagcaagcatattcctttcctgcaggag
aagaactcgttttacaatgtgtcctgtatcttaacattgccgccatatcagcgaaaaggc
tatgggagattgctcatcgatttcagctatctgctgacccgcgtggagggaaaaatcggc
tcgcctgagaaacctctatccgatctgggcctgatctcgtaccgctcatactggaaggat
gtgctcctggactacctgtgcaatcgatcgggaaacacgatcgccatcaaagatgtttcg
caggaaactgcgatatactcatacgacattgtgagcactcttcaagctctgggcatgatg
aagtactggaagggcaagcatatagtgctcaaaaagcaggatgtgctggatgagtacgag
gagagggtgaagcgaagaggaaccttccccaagatcgacgactcctgcttgagatggcag
ccctttatcaatatccagccgagctcatctccataa

DBGET integrated database retrieval system