KEGG   Drosophila yakuba: Dyak_GE14614Help
Entry
Dyak_GE14614      CDS       T01068                                 

Definition
GE14614 gene product from transcript GE14614-RA
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
dya  Drosophila yakuba
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dyak_GE14614
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    Dyak_GE14614
Enzymes [BR:dya01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     Dyak_GE14614
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 351 aa AA seqDB search
MFATPLRQPTAASPNPKSSPGMDDHGKPYQYEITDHGYGKDAVKVLHVSRKGPVHTIQEF
EVGTHLKLYSKKDYYQGNNSDIVATDSQKNTVYLLAKKHGIESPEKFALLLARHFINKYS
HVEEAHVHVEAYPWQRVCQEETRTPSNGKCENGGQGNCDFSSIDDRSLHNHAFVFTPTAF
HYCDVVVRRTDPKQTVITGIKGLRVLKTTQSSFVNFVNDEFRSLPDQYDRIFSTVVDCSW
EYSDTENLDFLRAWQTVKNIIIRNFAGDPQVGVSSPSVQHTLYLSERQVLDVLPQVSVIS
MTMPNKHYFNFDTKPFQKIAPGDNNEVFIPVDKPHGTIYAQLARKNINSHL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtttgccacgcccctcagacagcccactgcggcgagcccaaacccaaagagttccccc
ggcatggatgaccatggcaagccctatcagtacgagattaccgatcacggatacggcaag
gatgcggtcaaggtgctgcatgtcagtcgcaagggaccagtgcacaccatccaggaattc
gaggtgggcactcacctgaagctgtacagcaagaaagattactaccagggcaacaactcg
gacatcgtggccaccgattcgcagaagaacaccgtctatctgttggccaagaagcatggc
atcgagagtcccgagaagtttgccctgctcctggccaggcacttcattaacaagtactcg
cacgtggaggaggcccacgtccatgtggaggcctatccctggcagcgtgtttgccaggaa
gagaccagaacccccagcaatggaaagtgtgagaacggtggccaagggaactgcgacttt
agctccattgacgacagatcactgcacaatcacgcttttgtgttcactcccaccgctttc
cactactgcgatgtggttgtaaggagaacagatcccaaacaaacagtcatcaccggcatc
aaaggtcttcgagtgctgaagacgacccaatcctcgtttgtgaacttcgtgaacgacgag
ttcagatctctgccagatcagtacgaccgcatctttagcaccgtggtggactgctcatgg
gagtactccgacaccgaaaacttggacttcctgagggcctggcagacggtcaagaatata
atcattcgtaacttcgccggcgatccgcaggtgggcgtgtcctcgccctccgttcagcac
accctgtatctgagtgaaagacaggtcctggatgtcctgccgcaggtgtcggtcatttcg
atgaccatgccgaacaagcactacttcaatttcgatacgaagcccttccagaagattgct
cccggcgacaataacgaagtcttcatccccgtggacaagccacatggcaccatctatgcc
cagctggcccggaagaacatcaacagtcatctgtag

DBGET integrated database retrieval system