KEGG   Drosophila yakuba: Dyak_GE14825Help
Entry
Dyak_GE14825      CDS       T01068                                 

Definition
GE14825 gene product from transcript GE14825-RA
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
dya  Drosophila yakuba
Brite
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     Dyak_GE14825
Protein kinases [BR:dya01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   Dyak_GE14825
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 1089 aa AA seqDB search
MRFCFDRLCFATKRPAQNSNAPHSSTTVDAPSRSADVPVAPTSAAPPQQPPQQAVSNLFY
ADYQKLQPAIIDRHWERDRDTDTDTNTRSEAKPPDIVEHIEPVEQQQQQQQQQQRQIQTQ
IQIQIPPPAAPPSIEIQQRYRRHSSAEDRNLNTRRNDSNTTEALRKAASMQQEPNANYQF
PTDLGLVSIVNNNNNNTNTSTHPSGATISSSSSNNNNLVGGIVTLPAAGGLIGLEHTASG
LRLIPAPPTHSEVLTHTLIYGTPPSGAQQLNQDPRSLLHQQELQLQQRYQQLQQLQAQTQ
GLYTSQGSPVLYHQPSPGSSQPVAIPGATCHSPTQLQPPTTLNLQQQMQSLRISGCTPSG
SGGSATPSPVGLVDPNFIVSNYVAASPQEERFIQIIQAKELKIQEMQRALQFKDTEIAEL
KSHLDKFQSVFPFSRSSAAGCAGTGGASGSGAGGSGGSGPSTATGATRKSGQNFQRQRAL
GISAEPQSESSLLLEHVSFPKYDKDERSRELIKAAILDNDFMKNLDLTQIREIVDCMYPV
KYPAKNLIIKEGDVGSIVYVMEDGRVEVSREGKYLSTLSGAKVLGELAILYNCQRTATIT
AITECNLWAIERQCFQTIMMRTGLIRQAEYSDFLKSVPIFKDLAEDTLIKISDVLEETHY
QRGDYIVRQGARGDTFFIISKGKVRVTIKQQDTQEEKFIRMLGKGDFFGEKALQGDDLRT
ANIICESADGVSCLVIDRETFNQLISNLDEIKHRYDDEGAMERRKINEEFRDINLTDLRV
IATLGVGGFGRVELVQTNGDSSRSFALKQMKKSQIVETRQQQHIMSEKEIMGEANCQFIV
KLFKTFKDKKYLYMLMESCLGGELWTILRDKGNFDDSTTRFYTACVVEAFDYLHSRNIIY
RDLKPENLLLNERGYVKLVDFGFAKKLQTGRKTWTFCGTPEYVAPEVILNRGHDISADYW
SLGVLMFELLTGTPPFTGSDPMRTYNIILKGIDAIEFPRNITRNASNLIKKLCRDNPAER
LGYQRGGISEIQKHKWFDGFYWWGLQNCTLEPPIKPAVKSVVDTTNFDDYPPDPEGPPPD
DVTGWDKDF
NT seq 3270 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttctgctttgatcggctgtgcttcgcaaccaagcggccagcccaaaactccaat
gcaccacacagcagcaccactgtagatgcaccatcacgttcagcggatgtcccagtagca
ccaacatcagcagcaccaccacaacaaccaccacagcaggcagttagtaatctgttctat
gccgactaccagaagctgcagccggcgataatcgatcggcactgggagcgggacagagat
acagatacagatacgaataccaggagcgaggccaagccaccggacattgtagagcacata
gaacccgtagagcagcagcagcagcagcagcagcagcagcagcggcagatacaaacacag
atacagatacagataccccctcccgctgccccgccatcgatagagatacagcaacgctat
cgccggcacagcagtgccgaagatcgcaatctgaacacgaggcgaaacgattcgaatact
acggaggcgttacgaaaagcagccagtatgcagcaggagccgaacgccaactatcagttc
ccaaccgacttgggtctggtgagcatcgtcaacaataataataataacacaaacacaagc
acccatccgagtggagccaccatcagcagcagcagcagcaacaacaataatctggtgggt
ggcattgtgaccttgccggcggctggtggtctcataggactggagcatacggcgtcgggt
ctgcgactgataccagcaccgcccacccactcggaagtgctgacccacacgctgatctat
ggcacaccgccctcgggcgcccagcaactgaaccaggatccccgcagcctactgcaccaa
caggagctgcagctgcagcagcgctatcagcaattgcaacaactgcaggcacagacccaa
ggtctgtacaccagccaaggcagtccggtgctgtaccatcagcccagtccgggatcgagt
caaccggtggcgatacccggtgccacttgccattcgcccacacaactgcagccgcccacc
acgctgaatctgcagcagcagatgcagagtttgcggatctcgggatgcacgcccagcggt
tcgggtggctcggccacgccctcgccggtgggcctggtggatcccaacttcatagtgagc
aactatgtggccgcctcgccgcaggaggagcgcttcatccagatcattcaggccaaggag
ctcaagatacaggaaatgcaacgggcgctgcagttcaaggacaccgaaatagccgagctc
aagtcgcacttggacaaattccagagtgtctttcccttcagtcgcagcagtgcggcgggc
tgtgcgggcacgggcggcgcatccggatccggagccggcggaagtggcggcagtggtccc
agcaccgccaccggcgccacccgcaagtcgggacagaatttccagaggcagagggcgctg
ggtatctccgcggaaccgcagagcgagtcctcgctgctcctcgagcacgtcagctttccc
aaatacgacaaggatgagcgctcccgtgaacttatcaaggctgccatattggataatgat
ttcatgaagaacctggatctgacgcagatccgtgagatcgtcgactgcatgtacccggtg
aaatatccagccaagaatctaatcatcaaggagggagatgtcggaagcattgtttatgtc
atggaagatggacgcgtggaggtttcccgcgagggcaagtacctctccacgctgtcgggt
gcgaaggtccttggcgaactggcgatcctgtacaactgccagcgaacggcgaccatcacc
gcgatcaccgagtgcaacctgtgggccatcgagcgccagtgcttccagaccatcatgatg
cgaacgggcctcatccggcaggcggagtacagcgacttcctcaagagtgtgcccatcttc
aaagacctggcggaagacacgctcatcaaaatctccgatgtcttggaggagacgcactac
cagcgcggcgactacattgtgcgccagggcgccagaggcgataccttcttcatcatctcc
aagggaaaggtgcgtgtgacgatcaagcagcaggacacgcaggaggagaagttcatacgc
atgctgggcaaaggggatttctttggggagaaggctcttcagggcgatgatctgcgcacg
gcgaatattatttgcgagtccgccgatggcgtcagttgtctggtcatcgatcgcgagacc
ttcaatcagctgatttccaatctggacgagatcaagcatcgctacgacgacgagggcgcc
atggaacgcagaaagatcaatgaggaattccgagacatcaacctcacagatctgcgcgtc
atcgcaacccttggagttggaggcttcggtcgcgtagagctggtccaaacaaatggagat
agctccaggtccttcgccctcaagcagatgaaaaagtcacagattgtggaaacgcgacag
cagcagcacatcatgtccgagaaggagatcatgggcgaggccaattgccagttcatcgtg
aagctgttcaagaccttcaaggacaagaagtacctgtacatgctgatggagagctgtctg
ggcggcgaactctggacgattctgcgggacaagggcaacttcgacgacagcaccacccgc
ttctacacggcgtgtgtggtggaggcctttgattacctacactcgcgtaacatcatctat
cgtgatctgaagccggaaaacctgctgctcaatgaacgcggttatgtgaagctggtggac
tttggctttgccaagaagctgcagacgggcaggaagacctggactttctgcggcactcca
gagtacgtggctcccgaggtgattctcaaccggggtcatgacatcagtgcggattattgg
tcgctgggagtgctcatgttcgagttgcttactggcacccctccattcacgggctcggat
cccatgcgcacctacaacattatacttaagggtatcgacgccatcgaattcccaaggaat
atcacccgcaatgccagcaacctgatcaaaaagctctgtcgcgacaatcccgccgagcga
ttgggctaccagcgtgggggaatcagtgagatccagaagcacaaatggtttgatggcttc
tattggtggggcctgcagaactgcaccctggagccgcccattaagcccgccgtgaaaagc
gtggtcgataccaccaactttgatgactatccccctgatccagagggtccgccaccagac
gatgtcactggatgggacaaggacttctga

DBGET integrated database retrieval system