KEGG   Drosophila yakuba: Dyak_GE15022Help
Entry
Dyak_GE15022      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
dya  Drosophila yakuba
Pathway
dya00010  Glycolysis / Gluconeogenesis
dya00052  Galactose metabolism
dya00500  Starch and sucrose metabolism
dya01100  Metabolic pathways
dya04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dyak_GE15022
   00052 Galactose metabolism
    Dyak_GE15022
   00500 Starch and sucrose metabolism
    Dyak_GE15022
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dyak_GE15022
Enzymes [BR:dya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     Dyak_GE15022
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAP2
Motif
Other DBs
NCBI-GeneID: 6526623
NCBI-ProteinID: XP_002087731
FlyBase: FBpp0361492 FBgn0232612
UniProt: B4NX86
Position
2L
AA seq 350 aa AA seqDB search
METIMHVVSGAYNTTLSRELFINEWAQERLSFGKPLWHFFSVQLEPSNMFNIFIPLCGIF
SQEILLHLFTAITLISTLNSFEKWICPETRPLWFLREQYANRRVLKKPKVALESNQLSCE
VTGGLPCAHSMTFTVFVLILASFFFVRCWDRFVSWRSPFCRCLMYLLIIGMVVCMWLSRL
YLATEFLHQCILGSYFGIRALSTFEGHVKYLFSRPRGNAVSTVCFLGGLAVSVYFVKLQL
NMDPHWSVREGFKWCPEPTYLRHEVTPVFGLVRDLGNLMGLALASPLYKVEMKQSSFWRR
CRLLGLLEFVNYGLRLSTMKQSGRFAFLAYEFIRNAAHTLVLIKYLPKFY
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggagactataatgcacgttgtttcgggtgcatacaatacaacgctctcgcgcgagctt
ttcatcaacgaatgggctcaggaacgcttgagttttggaaagccactttggcactttttt
agcgttcaattggagccaagcaacatgttcaacatctttattcccctatgtggcattttt
agtcaggaaatcctattgcatctgttcacggcgattactcttattagcacactgaactcc
tttgaaaagtggatatgtccggagacgcgtcctttgtggtttctgcgtgagcagtatgcc
aataggagagtactcaagaaaccgaaggtggccctggaaagtaatcagctaagctgcgag
gttaccggtggactgccctgtgcccactcgatgaccttcaccgtgttcgtgctcatcctg
gcctcgttcttcttcgtccgctgctgggatcgctttgtgtcctggcgttcgcccttctgc
cgctgcctcatgtatctgctgatcattggaatggtggtctgcatgtggctgagtcgcctc
tatctggccaccgagtttctgcaccagtgcatcctgggcagttacttcgggatcagggcg
ctcagcaccttcgagggacatgtgaagtacttgttctcccgaccacgtggcaatgcagtc
tcaactgtttgcttcttgggaggattggcggtgtcggtgtactttgtgaagctgcaactt
aatatggatccccactggtcggtgcgcgagggtttcaaatggtgtccagagcccacatac
ttgcgtcacgaagttactccggtttttggactggtcagagatctaggcaatctaatggga
ctggctttggcctcgccgctatataaggtagaaatgaagcaatcatccttttggcggcgt
tgccgactccttggacttctggagtttgtcaattatggattgcgtctatccacgatgaag
cagtcgggtcgctttgctttcttggcctacgagttcataagaaatgccgcccataccctg
gtactgataaagtacctacccaaattttactag

DBGET integrated database retrieval system