KEGG   Drosophila yakuba: Dyak_GE15022Help
Entry
Dyak_GE15022      CDS       T01068                                 

Gene name
dyak_GLEANR_1608
Definition
(RefSeq) GE15022 gene product from transcript GE15022-RA
  KO
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
dya  Drosophila yakuba
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dyak_GE15022 (dyak_GLEANR_1608)
   00052 Galactose metabolism
    Dyak_GE15022 (dyak_GLEANR_1608)
   00500 Starch and sucrose metabolism
    Dyak_GE15022 (dyak_GLEANR_1608)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dyak_GE15022 (dyak_GLEANR_1608)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    Dyak_GE15022 (dyak_GLEANR_1608)
Enzymes [BR:dya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     Dyak_GE15022 (dyak_GLEANR_1608)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 318 aa AA seqDB search
METIMHVVSGAYNTTLSRELFINEWAQERQEILLHLFTAITLISTLNSFEKWICPETRPL
WFLREQYANRRVLKKPKVALESNQLSCEVTGGLPCAHSMTFTVFVLILASFFFVRCWDRF
VSWRSPFCRCLMYLLIIGMVVCMWLSRLYLATEFLHQCILGSYFGIRALSTFEGHVKYLF
SRPRGNAVSTVCFLGGLAVSVYFVKLQLNMDPHWSVREGFKWCPEPTYLRHEVTPVFGLV
RDLGNLMGLALASPLYKVEMKQSSFWRRCRLLGLLEFVNYGLRLSTMKQSGRFAFLAYEF
IRNAAHTLVLIKYLPKFY
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggagactataatgcacgttgtttcgggtgcatacaatacaacgctctcgcgcgagctt
ttcatcaacgaatgggctcaggaacgtcaggaaatcctattgcatctgttcacggcgatt
actcttattagcacactgaactcctttgaaaagtggatatgtccggagacgcgtcctttg
tggtttctgcgtgagcagtatgccaataggagagtactcaagaaaccgaaggtggccctg
gaaagtaatcagctaagctgcgaggttaccggtggactgccctgtgcccactcgatgacc
ttcaccgtgttcgtgctcatcctggcctcgttcttcttcgtccgctgctgggatcgcttt
gtgtcctggcgttcgcccttctgccgctgcctcatgtatctgctgatcattggaatggtg
gtctgcatgtggctgagtcgcctctatctggccaccgagtttctgcaccagtgcatcctg
ggcagttacttcgggatcagggcgctcagcaccttcgagggacatgtgaagtacttgttc
tcccgaccacgtggcaatgcagtctcaactgtttgcttcttgggaggattggcggtgtcg
gtgtactttgtgaagctgcaacttaatatggatccccactggtcggtgcgcgagggtttc
aaatggtgtccagagcccacatacttgcgtcacgaagttactccggtttttggactggtc
agagatctaggcaatctaatgggactggctttggcctcgccgctatataaggtagaaatg
aagcaatcatccttttggcggcgttgccgactccttggacttctggagtttgtcaattat
ggattgcgtctatccacgatgaagcagtcgggtcgctttgctttcttggcctacgagttc
ataagaaatgccgcccataccctggtactgataaagtacctacccaaattttactag

DBGET integrated database retrieval system