KEGG   Drosophila yakuba: Dyak_GE15202Help
Entry
Dyak_GE15202      CDS       T01068                                 

Definition
GE15202 gene product from transcript GE15202-RA
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
dya  Drosophila yakuba
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 227 aa AA seqDB search
MLTWTPLESNPEVLTKYIHKLGVSPAWSVTDVIGLEEDTLEWIPRPVKAFILLFPCSETY
EKHRAEEHERVKEVQEQHPNDLFYMRQFTHNACGTVALIHSVANNKEVDIDSGVLKNFLE
KTASLSPEERGKALESDKEFTADHQALAQEGQTNAADHETVIHHFIALVNKEGTLYELDG
RKSFPIKHGQTSEETFVKDAAKVCKEFMARDPNEVRFTVLALTAAQN
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgttgacctggacaccactagaatctaatcccgaggttttgaccaagtacatacataaa
ttgggcgtgtcgccagcctggtcggtaactgacgtcatcggtctggaagaggacaccttg
gagtggataccgcgtcccgtaaaggcgtttattttgctcttcccgtgcagcgaaacttat
gagaagcaccgcgccgaggagcacgaacgggtcaaggaggtgcaggagcagcatcccaac
gatctcttctatatgcgccagttcacccacaatgcctgtggcaccgtcgccttgatccac
agcgtggccaacaacaaagaagttgacatcgacagcggagtactgaagaacttcctggag
aagacagcttccttgtccccggaggaacgcggaaaggcccttgagagcgacaaggagttc
accgccgatcatcaggccttggctcaagagggccagaccaatgccgccgatcacgagacg
gtgattcaccacttcatcgctctggtgaacaaggagggtactctgtatgagctggatggg
cgcaagtccttcccgatcaagcacggacagacttcggaggagacttttgtaaaggatgca
gccaaggtatgcaaggagttcatggctcgcgatcccaacgaagtgcgcttcaccgttttg
gccctgactgccgcacaaaattag

DBGET integrated database retrieval system