KEGG   Drosophila yakuba: Dyak_GE15427Help
Entry
Dyak_GE15427      CDS       T01068                                 

Definition
GE15427 gene product from transcript GE15427-RA
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
dya  Drosophila yakuba
Pathway
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dyak_GE15427
Enzymes [BR:dya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     Dyak_GE15427
Exosome [BR:dya04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   Dyak_GE15427
  Exosomal proteins of breast milk
   Dyak_GE15427
Heparan sulfate/heparin binding proteins [BR:dya00536]
 Enzymes (General comment) Variety
  Dyak_GE15427
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 414 aa AA seqDB search
MPAHVKHLLLLGCLLCVLGDVPGIEAFHRWSPMMKAFRYFQETMLRNSLERAHLNHGIVF
ECRTISAKDFGNEVHFNLQLGDLRGFRRLDPNKKLALFLHGWNDQGSKDWVQELLLTWTL
FDSNYNVCVVDWGNLSQNDYKSASMSIFDVGLTVAGIIMALEELRPNHFHRSNVTLAGYS
LGAHAAGYAGAVLEGQVEQIIGLDPAGPLFSLPAEVAPKYRLDPGDAQFVQVLHTSGGSL
GTSLKCGHADFYPNGGRAPQTNCKMFANLRDMQNTNPVSCSHSAAAIFFRQSMDPEYPFV
GYECGSYREFSAGYCDGNRKARFGIHSQRRAQGSFYFRTAPQQPYVQRRQGNWLSGVGRQ
ATPKVSKGGQSPLVLRLWTNSWRRRERARERQRRDRDRGRERERERERSLCANK
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcccacgtgaaacacctcctgctccttggctgcctgctctgcgtgctcggcgat
gtgccgggcatcgaggccttccaccgctggagtcccatgatgaaggccttccgctatttc
caggagaccatgctgcggaatagcctggaacgcgcccatctcaatcatgggatcgtcttc
gagtgccgcaccatatcagccaaggattttggcaatgaagtgcacttcaatctgcaactt
ggagaccttcgaggatttcgtcgattggatccaaacaaaaagttggctctcttcttgcac
ggctggaatgatcagggcagcaaggattgggtgcaagaattattgctaacttggaccctt
ttcgactccaactacaatgtgtgcgttgtggactggggcaatctgtcgcagaacgactac
aagtccgcctccatgtccattttcgatgtgggtctaacggtggccggcatcatcatggcc
ctggaggagctgcgtcccaatcactttcatcggagcaacgtcaccctggcgggctacagt
ctgggtgcccatgccgctggttatgcgggcgcagtgctggagggtcaggtggagcagatc
attggcttggatcccgctggaccgctgttctcgctgcccgccgaggtggcgcccaagtac
cgcttggatcccggtgatgcccagttcgttcaggtgctgcacacatccggcggctccttg
ggcaccagtctgaagtgcggccatgccgatttctatcccaatggaggcagggcgccacag
acgaactgcaagatgtttgccaatctgcgcgacatgcagaataccaatcccgtttcctgc
agtcactcggcggcggcgattttcttccgccaatcgatggatcccgagtacccgttcgtg
ggctacgagtgcggcagctaccgcgagttctccgccggatattgcgatggcaaccggaag
gcgcgcttcgggatccattcgcagcggcgggcgcaggggagcttctacttccgcaccgcc
ccccagcagccgtacgtgcagaggcgtcagggcaactggttgagcggggtggggcgccag
gcaacgccgaaggtcagtaagggcggccagagcccccttgtgctgcgcctctggacgaac
agctggcggcggcgggagcgagcgagagagcgacagcggagggacagagacagaggcaga
gagagagagagggagagggagagatcgctgtgcgcgaataagtag

DBGET integrated database retrieval system