KEGG   Drosophila yakuba: Dyak_GE15427Help
Entry
Dyak_GE15427      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
Organism
dya  Drosophila yakuba
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
X
AA seq 414 aa AA seqDB search
MPAHVKHLLLLGCLLCVLGDVPGIEAFHRWSPMMKAFRYFQETMLRNSLERAHLNHGIVF
ECRTISAKDFGNEVHFNLQLGDLRGFRRLDPNKKLALFLHGWNDQGSKDWVQELLLTWTL
FDSNYNVCVVDWGNLSQNDYKSASMSIFDVGLTVAGIIMALEELRPNHFHRSNVTLAGYS
LGAHAAGYAGAVLEGQVEQIIGLDPAGPLFSLPAEVAPKYRLDPGDAQFVQVLHTSGGSL
GTSLKCGHADFYPNGGRAPQTNCKMFANLRDMQNTNPVSCSHSAAAIFFRQSMDPEYPFV
GYECGSYREFSAGYCDGNRKARFGIHSQRRAQGSFYFRTAPQQPYVQRRQGNWLSGVGRQ
ATPKVSKGGQSPLVLRLWTNSWRRRERARERQRRDRDRGRERERERERSLCANK
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcccacgtgaaacacctcctgctccttggctgcctgctctgcgtgctcggcgat
gtgccgggcatcgaggccttccaccgctggagtcccatgatgaaggccttccgctatttc
caggagaccatgctgcggaatagcctggaacgcgcccatctcaatcatgggatcgtcttc
gagtgccgcaccatatcagccaaggattttggcaatgaagtgcacttcaatctgcaactt
ggagaccttcgaggatttcgtcgattggatccaaacaaaaagttggctctcttcttgcac
ggctggaatgatcagggcagcaaggattgggtgcaagaattattgctaacttggaccctt
ttcgactccaactacaatgtgtgcgttgtggactggggcaatctgtcgcagaacgactac
aagtccgcctccatgtccattttcgatgtgggtctaacggtggccggcatcatcatggcc
ctggaggagctgcgtcccaatcactttcatcggagcaacgtcaccctggcgggctacagt
ctgggtgcccatgccgctggttatgcgggcgcagtgctggagggtcaggtggagcagatc
attggcttggatcccgctggaccgctgttctcgctgcccgccgaggtggcgcccaagtac
cgcttggatcccggtgatgcccagttcgttcaggtgctgcacacatccggcggctccttg
ggcaccagtctgaagtgcggccatgccgatttctatcccaatggaggcagggcgccacag
acgaactgcaagatgtttgccaatctgcgcgacatgcagaataccaatcccgtttcctgc
agtcactcggcggcggcgattttcttccgccaatcgatggatcccgagtacccgttcgtg
ggctacgagtgcggcagctaccgcgagttctccgccggatattgcgatggcaaccggaag
gcgcgcttcgggatccattcgcagcggcgggcgcaggggagcttctacttccgcaccgcc
ccccagcagccgtacgtgcagaggcgtcagggcaactggttgagcggggtggggcgccag
gcaacgccgaaggtcagtaagggcggccagagcccccttgtgctgcgcctctggacgaac
agctggcggcggcgggagcgagcgagagagcgacagcggagggacagagacagaggcaga
gagagagagagggagagggagagatcgctgtgcgcgaataagtag

DBGET integrated database retrieval system