KEGG   Drosophila yakuba: Dyak_GE15438Help
Entry
Dyak_GE15438      CDS       T01068                                 

Definition
GE15438 gene product from transcript GE15438-RA
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
dya  Drosophila yakuba
Pathway
FoxO signaling pathway
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dya00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dyak_GE15438
   04330 Notch signaling pathway
    Dyak_GE15438
   04350 TGF-beta signaling pathway
    Dyak_GE15438
   04630 Jak-STAT signaling pathway
    Dyak_GE15438
   04068 FoxO signaling pathway
    Dyak_GE15438
Enzymes [BR:dya01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dyak_GE15438
Transcription factors [BR:dya03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    Dyak_GE15438
Mitochondrial biogenesis [BR:dya03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    Dyak_GE15438
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 3304 aa AA seqDB search
MADHLDEPPQKRVKMDPTDISYFLEENLPDELVSSNSGWSDQLTGGAGGGNGGGGASGVT
TNSTSGPNPGGGPNKPAAQGPGSGTGGVGVGVNVAVGGVVGVGVVPSQMNGAGGGNGSGT
GGDDGSGNGSGAGNRISQMQHHQQLQHLLQQQQQGQKGAMVVPGMQQLGSKSPNLQSPNQ
GGMQQVVGTQMGMVNSMPMSISNNGNNGMNAIPGMNTIAQGNLGNMVLTNSVGGGMGGMV
NHLKQQPGGGGGGMINAVSVPGGPGSGAGGVGAGGGGAVTTNQGMHMQNGPMMGRMVGQQ
HMLRGPHLMGAAGGAGGPGNGPGGGGPRMQNPNMQMTQLNSLPYGVGQYGGPGGGNNPQQ
QQQQQLLAQQMAQRGGVVPGMPQGNRPVGTVVPMSTLGGDGSVPAGQLVSGNPQQQQMLA
QQQTGAMGPRPPQPNQLLGHPGQQQQQQPGTSQQQQQGVGLGGAGVVANAGTVAGVPTGA
GGGAGGAVQASGPGGANRDVPDDRKRQIQQQLMLLLHAHKCNRRENLNPNREVCNVNYCK
AMKSVLAHMGTCKQSKDCTMQHCASSRQILLHYKTCTNSGCVICYPFRQNHSVFQNANVP
PGGGPPGIGGAPPGGGGAAGGAAGAGGNLQQQQQQQQQQQQQQQQQQQNQQPNLTGLVVD
GKQGQQVAPGGGQNTAIVLPQQQGAGGAPGAPKTPADMVQQLTQQQQQQQQQVHQQQVQQ
QELRRFDGMGQVGLSPVPAGGMQQQQQGLPPVIRMQGAQPAVRVLGPGGPGGPSGPNVLP
NDVNSLHQQQQQMLQQQQQQQQGQNRRRGGLATMVEQQQQQQQQQQQQQQQQPNPAQLGG
NIPTPLSVNVAFGNANFGGAAAGGAVGANDKQQLKVAQVHPQSHGVGAGGAAAGAGASGG
QVAAGSSVLMPADTTGSGNAGNPNQNAGGGAGGAGGGNGGNSGPPGDNEKDWRESVTADL
RNHLVHKLVQAIFPTSDPTTMQDKRMHNLVSYAEKVEKDMYEMAKSRSEYYHLLAEKIYK
IQKELEEKRLKRKEQHQQMLMQQQGVANPVAGGAAGGAGSAAGGAGGVVLPQQQQQQQQQ
QQQQQGQQPLQSCIHPSISPMGGVMPPQQLRPQGPPGILGQQTAAGLGVGVGVTNNMVTM
RSHSPGGNMLALQQQQRMQFPQQQQQQPPGSGAGKMLVGPPGPSPGGMVVNPALSPYQTT
NVLTSPVPGQQQQQQFINANGGTGANPQLSEMMKQRHIHQQQQQQQQVQQQGMLLPQSPF
NNATPLQQQQQQQQQATSNSFSSPMQQQQQQQQQQQQQQQQGQQQQQQKPGSVLNNMPPT
PTSLEALNAGAGAPLTGGSASNVTVSAPSPSPGFLSNGPSIGTPSNNNNSSSANNNPPSV
SSLMQQPLSNRPGTPPYIPASPVPATSASGLAASSTPASAAATCASSGSGSNSSSGATAA
GASSTSSSSSAGSGTPLSSVSTPTSATMATSSGGGGGAGGAGGGSSTTPASNPLLLMSGG
TAGGGTGATTTTSTSSSSRMMSSSSSLSSQMAALEAAARDNDDETPSPSGENTNGSGGSG
NAGGMASKGKLDSIKQDDDIKKEFMDDSCGGNNDSSQMDCSTGGGKGKNVNNDGTSMIKM
EIKTEEGLDGEVKIKTEAMDVDEAGGSTAGEHHGEGGGGSGVGGGKDNINGAHDGGSAGG
ALDIKPKTDTKPLVPEPLAPNAGDKKKKCQFNPEELRTALLPTLEKLYRQEPESVPFRYP
VDPQALGIPDYFEIVKKPMDLGTIRTNIQNGKYSDPWEYVDDVWLMFDNAWLYNRKTSRV
YRYCTKLSEVFEAEIDPVMQALGYCCGRKYTFNPQVLCCYGKQLCTIPRDAKYYSYQNSL
KEYGVASNRYTYCQKCFNDIQGDTVTLGDDPLQSQTQIKKDQFKEMKNDHLELEPFVDCQ
ECGRKQHQICVLWLDSIWPGGFVCDNCLKKKNSKRKENKFNAKRLPTTKLGVYIETRVNN
FLKKKEAGAGEVHIRVVSSSDKCVEVKPGMRRRFVEQNEMMNEFPYRAKALFAFEEVDGI
DVCFFGMHVQEYGSECPAPNTRRVYIAYLDSVHFFRPRQYRTAVYHEILLGYMDYVKQLG
YTMAHIWACPPSEGDDYIFHCHPTDQKIPKPKRLQEWYKKMLDKGMIERIIQDYKDILKQ
AMEDKLGSAAELPYFEGDFWPNVLEESIKELDQEEEEKRKQAEAAEAAAAANLFSIEENE
VSGDGKKKGQKKAKKSNKSKAAQRKNSKKSNEHQSGNDLSAKIYATMEKHKEVFFVIRLH
SAQSAASLAPIQDPDPLLTCDLMDGRDAFLTLARDKHFEFSSLRRAQFSTLSMLYELHNQ
GQDKFVYTCNHCKTAVETRYHCTVCDDFDLCIVCKEKVGHQHKMEKLGFDIDDGSALADH
KQANPQEARKQSIQRCIQSLVHACQCRDANCRLPSCQKMKRVVQHTKNCKRKTNANGGCP
ICKQLIALCCYHARHCQEQKCPVPFCPNIKHKLKQQQSQQKFQQQQLLRRRVALMSRTSA
PTALQGPPAVSGPTVVSGGVPVVGMSGVAVSQQVIPGQAGILPPGAGGMSPSTVAVPSPV
SGGAGAGGMGGMTSPHPHQSGIGMKPGGGHSPSPNVLQVVKQVQEEAARQQVSHGGGFGK
GVPMAPPVMNRPMGGAGPNQNVVNQLGGMGVGVGGVGGVGVGGVGGVGVNQLNSGGGGNT
PGGPIPGSGMNHLMSMDQWGGGGAGGGGGNPGGGNPQARYANNTGGMRQPNQMMQTNLIP
PQQQMMGSLGGPNQLGGGQMPVGGQHGGMGMGMGAPPMAGTVGGVRPTPGAGGGGGGATG
GGLNNQQLAQIMQKIKNNPTNESNQHILTILKQNPQIMAAIIKQRQQSHQSQINAAAGGG
APGPGGGALQQQQQQQAGNGPQNPQQQQQQQQQQQQQQQQQVMQQQQMQHMMNQQQGGGG
PQQMNPNQQQQQQQVNLMQQQQQQQVGPGGPGSGLPTRMPNMPNALGMLQSLPPNMSPGV
SAQGGMVPNQNWNKMRYMQMGQYPPPYPQRQRGPHMGGAGPGPGQQQFPGGGGGAGNFNA
GGAGGAGGVVGVGGVPGGAGSVPGGDQYSMANAAAASNMLQQQQGQVGVGVGVGVKPGPG
QQQQQMGVGMPPGMQQQQQQQQQQPLQQQQMMQVSMPNANAQNPSAVVGGPNAQVMGPPT
PHSLQQQLMQSARSSPPIRSPQPTPSPRSAPSPRAAPSASPRAQPSPHHVMSSHSPAPQG
PPHDGMHNHGMHHQSPLPGVPQDVGVGVGVGVGVGVNVGNVGVGNAGGALPDASDQLTKF
VERL
NT seq 9915 nt NT seq  +upstreamnt  +downstreamnt
atggccgatcacttagacgaaccgccccaaaagcgggttaaaatggatccaacggacatc
tcctactttctggaggagaacctgcctgatgagctggtgtcctcgaacagcggctggtcg
gatcagctgaccggcggagcaggcggtggcaatggaggtggcggcgcctccggtgtgacc
acaaattccacatccggcccaaatcccggtggcggacccaacaaaccggcagcccaagga
cctggctctggcactggcggagtcggtgttggagtcaatgtggccgtcggcggtgttgtc
ggcgtcggcgttgtgccttcccagatgaacggagccggcggcggcaacggatccggaacg
ggcggcgacgacggcagtggcaacggctccggagcgggcaacagaatcagtcaaatgcag
caccaccagcagctgcagcacctactccagcagcagcagcagggccagaagggcgccatg
gtggtgcccggaatgcagcagctgggcagcaagtcgcccaacctacagtcacccaaccag
ggtggcatgcagcaggtggtgggcactcagatgggtatggtcaactcaatgcccatgtca
atatcgaataatggcaacaatggcatgaacgccataccaggcatgaacaccattgcgcag
ggcaatctgggaaacatggtgctgaccaacagcgttggcggcggcatgggcggcatggtc
aatcatctcaagcagcagcctggcggcggcggcggtgggatgatcaatgccgtttcggta
ccaggaggacctggatcaggagctggaggcgttggagctggcggcggtggtgccgttacc
acaaaccaaggcatgcatatgcagaacggcccgatgatgggccgaatggtggggcaacag
catatgctacgtggcccccatctcatgggtgccgctggaggagctggtgggcctggaaat
ggacctggtggcggcggtccacgcatgcagaatcccaacatgcaaatgactcaactcaac
agtctgccgtacggagtgggtcagtatggtggtccaggcggtggcaacaatcctcagcag
caacagcagcaacaactcctcgcccagcagatggcccaaagaggcggcgtcgtaccgggc
atgccgcagggcaatcgacccgttggcacagtggtgcccatgtccacactcggtggcgat
ggttcagtgcccgcggggcagctggtcagcggtaatcctcagcagcaacagatgctggcg
caacagcaaaccggagccatgggcccgcgtcctccgcaacccaatcagctgctcggtcat
cccggacagcagcagcaacagcagccaggcacctcgcagcagcagcaacagggagttgga
ctcggaggcgcaggcgttgtggccaatgcaggaaccgttgctggcgtgccgacaggagca
ggcggcggagccggtggcgccgtacaagccagcggacctggtggcgccaatcgcgatgtg
cccgacgaccgtaagcgacagatccagcagcaactgatgctactcctccatgcacacaag
tgcaatcgcagggagaacctgaatccgaacagggaggtgtgcaacgtcaattactgcaag
gcgatgaaatcagtgctggcccacatgggcacttgcaaacagagcaaggactgcaccatg
cagcattgtgcctcctcgcgccaaatcctgttgcattacaagacgtgcacgaacagtggc
tgcgtgatttgctatcccttccggcagaatcattcggtttttcaaaatgctaatgtgccg
ccaggaggcgggccgcctggaattggaggtgcgcctccaggtggcggcggagcggctggt
ggagcggctggagcaggcggtaatcttcagcagcaacagcagcagcagcagcaacaacag
cagcagcagcagcagcagcagcaaaaccagcagcccaatctgacgggtctggtggtggat
ggcaagcaaggacaacaggttgcaccaggaggtggtcagaacactgccatagttctaccc
cagcagcagggagcgggcggtgcaccgggtgcgccaaaaacgcctgcggacatggtgcaa
caattgacccaacagcagcagcagcagcaacagcaggtgcaccagcagcaggttcagcaa
caggaactccgtcgattcgatggcatgggccaagttggactatcgcccgtgccagctggt
ggtatgcagcagcagcagcagggtttgcctcctgtgattcgcatgcaaggcgctcagccg
gccgtcagggttctgggaccaggtggtcccggcggcccaagtggtcccaatgtactgccc
aacgatgttaacagcctgcatcaacaacagcagcagatgctccagcagcagcagcagcag
caacagggccaaaatcgacgacgcggtggcctcgccaccatggtcgagcagcaacaacaa
cagcagcagcagcagcagcaacaacaacagcagcaacccaatcccgcccagctgggtggc
aacattccaacaccactctctgttaacgtcgcctttggcaatgccaatttcggtggtgcg
gcagccggcggagccgtgggagccaatgataagcaacagctgaaggtggcccaagtgcat
ccgcagagccatggcgttggagcgggcggagcggcagcgggcgccggtgcgagtggtggt
caagtggcagctggttccagtgtactgatgccagccgataccacgggcagtggtaatgca
ggcaatcccaaccagaatgcaggcggtggagcaggaggcgccggcggtggcaatggcgga
aactctggaccaccgggcgacaacgagaaagactggcgggaatcggtgaccgccgatctg
cgcaaccacctcgtccacaaactggtgcaggccatcttccccacctcggatcccacgacc
atgcaggacaagcggatgcataatctcgtttcctacgcggaaaaggtcgagaaggacatg
tacgaaatggccaagtccagatcggagtactatcacctgctggccgagaagatctacaag
atccaaaaggagctggaggagaagcgactgaagcgtaaagagcagcaccaacaaatgctg
atgcagcagcagggcgttgcgaatccagtggctggaggagcggctggcggcgcaggcagt
gcagctggtggagcgggcggtgtagtcttgccccagcagcagcagcagcagcaacaacag
cagcagcagcagcagggtcaacagccgctgcagagctgtatccatccaagcatcagtcca
atgggcggtgtgatgcctccgcagcagctgcgtccacaaggaccacctggaatactgggc
cagcagactgcagcaggcctgggcgtcggcgtgggtgtcaccaacaacatggtgaccatg
cgcagtcattcgcccggtggcaacatgctcgccctgcagcaacaacagcgcatgcagttc
ccgcaacaacagcagcaacaaccgcccggttctggtgccggcaaaatgctggtaggccca
ccaggacccagtcccggtggcatggtggtcaatcccgcgctctcgccttaccagacgacc
aatgtgctcaccagtccggtgccgggacagcagcaacagcagcagttcatcaatgcgaac
ggcggcactggtgccaatcctcagctgagcgagatgatgaagcagcgacacattcaccag
cagcagcaacagcaacagcaggtgcagcagcagggaatgttgttgccgcagtcgccattc
aacaatgccacacctctacaacaacaacagcagcagcagcagcaggcgactagcaacagc
tttagctcaccaatgcagcaacagcagcagcagcaacaacagcagcagcagcagcagcag
caaggtcagcaacagcaacaacagaagcccggcagtgtgctgaacaatatgccgcccacg
cccacgagtctggaagctctgaatgcgggagctggagcgccgttaacgggaggatctgcc
tccaatgtgacggtttccgctccgagcccatcgcccggcttcctgtccaatggcccgtcg
attggcacgccctccaacaataataatagtagtagtgctaacaacaacccgccctcggtg
agcagtctaatgcaacagccgctgagcaatcggccgggtacgcctccatatatacccgcc
tccccagtgccggcgacaagtgcctccggattggcggcgagcagtacgcccgcatcagca
gcagccacatgtgcgagtagtggcagtgggagcaatagcagcagtggagccactgcagcg
ggtgcaagttccacgtcatcatcttcctcggcgggctcgggtacaccactcagctcggta
tcgactcctacatcggccacgatggccaccagcagcggtggtggtggtggtgctggcggt
gcgggaggcggttcatccacaacgcccgctagcaatccactgctcctcatgtctggagga
acggcaggaggcggaacgggagcgacgaccaccacatcgacatcttcgagcagtcgcatg
atgagcagctccagcagtctctcctcacagatggctgccctggaggctgcggcgcgagac
aacgacgatgagacaccatcgccgtccggcgagaatacgaatggcagtggtggaagtgga
aatgccggcggtatggcctccaagggcaagctggactccattaagcaagatgatgatatc
aagaaggagtttatggatgacagctgtggcggcaataacgatagctcgcaaatggattgc
tcgacgggcggtggcaagggcaagaatgtgaacaacgacggcaccagcatgatcaaaatg
gagatcaagacggaggagggactcgatggcgaggtgaagatcaaaacggaggccatggat
gtggacgaggctggtggatcgacagccggtgagcatcatggtgaaggtggcggcggcagt
ggtgttggcggcggcaaggacaacatcaatggtgcgcacgacggtggatcggcaggcggt
gctttggacataaaacccaagacggatacgaaaccactcgtacccgaaccgctggcaccc
aatgcgggcgataagaaaaagaagtgccaattcaatcccgaagagttgcgcaccgctttg
ctgccgacgctggagaagctctacaggcaggagcccgagtccgtgccctttcgctaccca
gttgatccccaggcgctgggcatacccgattactttgagatcgtgaagaagcccatggac
ctgggcaccatacgcaccaacatacagaatggcaagtacagtgatccctgggagtatgtg
gacgacgtttggctgatgttcgacaatgcctggctgtataatcgcaaaacatcgcgggtc
tatcgctattgcacaaagctttccgaagtctttgaggcggagatcgatcctgtgatgcag
gcgctgggctattgctgcggcaggaagtacacattcaatccacaggtgctctgctgctac
ggcaagcagctgtgcacaattccgcgggatgcaaagtactacagctaccagaacagtcta
aaggaatacggtgtcgcctcaaatagatacacctactgccaaaagtgctttaacgacatc
cagggcgatacggtcacactgggcgacgatccactgcaatcgcaaacccaaatcaaaaag
gaccagttcaaggagatgaagaacgatcacctcgagctggagccgtttgtcgattgccag
gagtgcggacgcaaacagcatcagatctgcgtcctctggctggactccatttggcccggt
ggctttgtgtgcgacaactgtctgaagaagaagaactcgaagcggaaggagaacaagttc
aatgcgaaacgcctgcccaccaccaagctgggcgtgtacatagagacgcgggtgaacaac
ttcctcaagaagaaggaggctggtgccggcgaggtgcacatacgtgtggtcagctcatcg
gacaagtgtgtggaggtgaagcccgggatgcggcgacgattcgtcgaacagaatgagatg
atgaacgagtttccttatcgggccaaagcactcttcgccttcgaggaggtggacggcatc
gatgtgtgcttctttggcatgcacgtccaggagtatggatccgagtgcccggcgccgaat
acgcgtcgtgtgtacattgcctatttggattccgttcatttcttccggccaagacagtac
cgtacagcggtatatcacgaaatcctgctcggctacatggactacgtgaaacagctgggc
tacacaatggcccacatctgggcctgtccgccatccgagggcgatgactacatcttccac
tgccatcccacggaccagaagatacccaagcccaaacgcctgcaggagtggtacaagaag
atgcttgacaagggcatgatcgagcgcatcatacaggactacaaggatatcctcaagcag
gcgatggaggacaaactgggctccgccgccgagttgccctactttgagggcgacttctgg
cccaatgtgctggaggagagcatcaaggaactggaccaggaggaggaggagaagcgcaag
caggccgaggccgcggaagcagcagctgcggcaaatcttttctccatcgaggagaacgag
gtcagcggcgatggcaaaaagaagggccaaaagaaggccaagaagtcgaacaaatcgaaa
gcggcgcagcgtaagaacagcaaaaagtccaatgaacatcaatcgggcaacgatctctcc
gccaagatatatgcgaccatggagaagcacaaggaggtattcttcgtcatccgtctgcat
tcggcgcagtccgcagctagtttagcgcccatccaagatcccgatccgctgctcacatgc
gatctgatggacggacgcgatgccttcctgaccctcgcccgcgacaagcactttgagttc
tcgtcgctccggcgcgcacagttctccacactgtccatgttgtatgagctgcataaccag
ggtcaggacaagttcgtttacacctgcaatcactgcaagacggctgtggagacgcgctac
cactgcactgtttgtgatgactttgatctgtgtatcgtgtgcaaggagaaggttggccat
cagcacaagatggagaagctcggcttcgacatcgacgacggctctgcgctggcggatcac
aagcaggcaaatccgcaggaggcccgcaagcagtccatccagcgttgcatccaatcgctg
gtgcacgcctgccagtgtcgcgatgccaactgccgcctgccatcgtgccagaagatgaag
cgcgtcgtccagcacacaaagaactgcaagcgcaagaccaacgccaacggtggttgcccc
atttgcaagcagctcatcgccctctgttgctaccatgccaggcactgtcaggagcagaag
tgccccgtgccgttctgtcccaacatcaagcacaagctcaagcagcagcagtctcagcag
aaattccagcagcagcagttgctgcgtcgtcgcgtggcgctcatgtcgcgcacatcggcg
ccaacggctctgcaaggcccacctgcagtaagcggtccgaccgtcgtctctggcggagtg
cccgtggtgggcatgtccggtgtggcagttagccaacaggtgatacccggccaggctggt
atactgccgccaggagcgggtggcatgtcgccatctaccgtggcagtaccatcgcccgtt
tcaggaggagctggcgccggtggtatgggcggaatgacctcaccacatccgcatcaatcg
ggcataggcatgaaaccaggtggcggtcactcgccgtcaccaaatgtcctacaagtggtg
aagcaggtccaggaggaggcagcgcgccagcaggtttcgcatggcggtggcttcggcaag
ggtgtacccatggcgccgcccgtgatgaatcgaccaatgggaggcgcaggacccaaccaa
aatgttgtcaatcaactcggtggcatgggcgttggagttggtggtgtcggtggcgttggc
gtcggaggcgttggcggtgtgggtgtcaatcaactgaattcgggtggtggtggcaataca
ccaggtggcccgatacccggctccggaatgaatcacctgatgtccatggatcagtggggc
ggtggcggagccggcggcggtggtggcaatcccggcggaggtaatccgcaagcgcgctat
gccaacaacaccggcggcatgcgccagcccaaccagatgatgcaaacgaatctgataccg
ccgcagcaacagatgatgggcagtctgggcggacccaatcaactgggtggtggccaaatg
ccagtcggcggacagcatggaggcatgggaatgggcatgggagcaccgccaatggccgga
actgttggcggtgtgcgtccaacccccggagcaggtggcggaggtggaggtgcaactggg
ggcggtctaaataaccaacaactcgcccagatcatgcagaagatcaagaacaatcccacc
aacgagagcaaccagcacatcctcaccatactgaaacagaatccgcagatcatggcggcg
atcatcaagcagcgccagcagagccatcagtcgcaaatcaatgcggcggcgggcggagga
gcacctggccccggtggtggagccttgcagcagcaacagcagcagcaggcgggcaacgga
ccgcagaatcctcaacagcagcagcagcagcaacaacaacagcagcagcagcagcagcaa
caggtgatgcagcaacagcagatgcagcacatgatgaaccagcagcagggcggtggcggt
ccacagcagatgaatcccaaccagcagcagcaacagcagcaggtcaatctcatgcagcag
cagcagcagcaacaagttggacccggcggaccaggctcaggactgcccacgcgcatgccc
aacatgcccaatgccttgggcatgctgcagagccttccgcccaacatgtcgcccggagtt
tccgcccagggaggaatggtgcccaaccagaactggaacaagatgcgttacatgcagatg
ggccagtacccgccaccgtatccgcagcgccagcgtggtccgcacatgggcggagcggga
cccggtcccggccagcaacagttccccggtggcggcggtggtgcgggcaacttcaatgcg
ggcggtgctggcggtgccggcggcgttgtcggtgtgggcggagtgcccggtggagctggt
tcggtgcccggtggcgatcagtactcgatggcgaatgcggcggccgcctccaatatgctg
caacagcagcagggacaggtgggggtcggcgtgggcgtcggtgtgaagccaggacccggc
caacagcaacagcagatgggcgtgggcatgccgccgggcatgcagcagcaacagcagcag
cagcaacaacagccgctgcagcagcagcaaatgatgcaggtgtccatgccgaatgcgaat
gcccagaatccgtcggcggtggtgggcggacccaatgcccaggtgatgggtccaccaacg
ccgcactctctgcaacagcagctaatgcaatcggcccgttcgtcgccgccaattcgctcg
ccgcagccaacgccatcgccacgttcggcgccgtcgccacgtgctgctccatccgcctcg
ccaagggcacagccctcgccgcaccatgtgatgagcagccattcgccggcgccgcaggga
ccaccgcatgatggtatgcacaatcatggcatgcatcatcagtcaccgctgccaggagtg
ccgcaggatgtgggcgtgggcgtcggagtcggtgtcggcgttggcgttaacgttggtaac
gtgggcgtgggcaacgccggtggagccctgcccgacgcctccgaccagctgaccaagttt
gtggagagactctag

DBGET integrated database retrieval system