KEGG   Drosophila yakuba: Dyak_GE15438Help
Entry
Dyak_GE15438      CDS       T01068                                 

Gene name
dyak_GLEANR_16953
Definition
(RefSeq) GE15438 gene product from transcript GE15438-RB (EC:2.3.1.48)
  KO
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
dya  Drosophila yakuba
Pathway
FoxO signaling pathway
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:dya00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dyak_GE15438 (dyak_GLEANR_16953)
   04330 Notch signaling pathway
    Dyak_GE15438 (dyak_GLEANR_16953)
   04350 TGF-beta signaling pathway
    Dyak_GE15438 (dyak_GLEANR_16953)
   04068 FoxO signaling pathway
    Dyak_GE15438 (dyak_GLEANR_16953)
Enzymes [BR:dya01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dyak_GE15438 (dyak_GLEANR_16953)
Transcription factors [BR:dya03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    Dyak_GE15438 (dyak_GLEANR_16953)
Chromosome [BR:dya03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    Dyak_GE15438 (dyak_GLEANR_16953)
Mitochondrial biogenesis [BR:dya03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    Dyak_GE15438 (dyak_GLEANR_16953)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 3305 aa AA seqDB search
MMADHLDEPPQKRVKMDPTDISYFLEENLPDELVSSNSGWSDQLTGGAGGGNGGGGASGV
TTNSTSGPNPGGGPNKPAAQGPGSGTGGVGVGVNVAVGGVVGVGVVPSQMNGAGGGNGSG
TGGDDGSGNGSGAGNRISQMQHHQQLQHLLQQQQQGQKGAMVVPGMQQLGSKSPNLQSPN
QGGMQQVVGTQMGMVNSMPMSISNNGNNGMNAIPGMNTIAQGNLGNMVLTNSVGGGMGGM
VNHLKQQPGGGGGGMINAVSVPGGPGSGAGGVGAGGGGAVTTNQGMHMQNGPMMGRMVGQ
QHMLRGPHLMGAAGGAGGPGNGPGGGGPRMQNPNMQMTQLNSLPYGVGQYGGPGGGNNPQ
QQQQQQLLAQQMAQRGGVVPGMPQGNRPVGTVVPMSTLGGDGSVPAGQLVSGNPQQQQML
AQQQTGAMGPRPPQPNQLLGHPGQQQQQQPGTSQQQQQGVGLGGAGVVANAGTVAGVPTG
AGGGAGGAVQASGPGGANRDVPDDRKRQIQQQLMLLLHAHKCNRRENLNPNREVCNVNYC
KAMKSVLAHMGTCKQSKDCTMQHCASSRQILLHYKTCTNSGCVICYPFRQNHSVFQNANV
PPGGGPPGIGGAPPGGGGAAGGAAGAGGNLQQQQQQQQQQQQQQQQQQQNQQPNLTGLVV
DGKQGQQVAPGGGQNTAIVLPQQQGAGGAPGAPKTPADMVQQLTQQQQQQQQQVHQQQVQ
QQELRRFDGMGQVGLSPVPAGGMQQQQQGLPPVIRMQGAQPAVRVLGPGGPGGPSGPNVL
PNDVNSLHQQQQQMLQQQQQQQQGQNRRRGGLATMVEQQQQQQQQQQQQQQQQPNPAQLG
GNIPTPLSVNVAFGNANFGGAAAGGAVGANDKQQLKVAQVHPQSHGVGAGGAAAGAGASG
GQVAAGSSVLMPADTTGSGNAGNPNQNAGGGAGGAGGGNGGNSGPPGDNEKDWRESVTAD
LRNHLVHKLVQAIFPTSDPTTMQDKRMHNLVSYAEKVEKDMYEMAKSRSEYYHLLAEKIY
KIQKELEEKRLKRKEQHQQMLMQQQGVANPVAGGAAGGAGSAAGGAGGVVLPQQQQQQQQ
QQQQQQGQQPLQSCIHPSISPMGGVMPPQQLRPQGPPGILGQQTAAGLGVGVGVTNNMVT
MRSHSPGGNMLALQQQQRMQFPQQQQQQPPGSGAGKMLVGPPGPSPGGMVVNPALSPYQT
TNVLTSPVPGQQQQQQFINANGGTGANPQLSEMMKQRHIHQQQQQQQQVQQQGMLLPQSP
FNNATPLQQQQQQQQQATSNSFSSPMQQQQQQQQQQQQQQQQGQQQQQQKPGSVLNNMPP
TPTSLEALNAGAGAPLTGGSASNVTVSAPSPSPGFLSNGPSIGTPSNNNNSSSANNNPPS
VSSLMQQPLSNRPGTPPYIPASPVPATSASGLAASSTPASAAATCASSGSGSNSSSGATA
AGASSTSSSSSAGSGTPLSSVSTPTSATMATSSGGGGGAGGAGGGSSTTPASNPLLLMSG
GTAGGGTGATTTTSTSSSSRMMSSSSSLSSQMAALEAAARDNDDETPSPSGENTNGSGGS
GNAGGMASKGKLDSIKQDDDIKKEFMDDSCGGNNDSSQMDCSTGGGKGKNVNNDGTSMIK
MEIKTEEGLDGEVKIKTEAMDVDEAGGSTAGEHHGEGGGGSGVGGGKDNINGAHDGGSAG
GALDIKPKTDTKPLVPEPLAPNAGDKKKKCQFNPEELRTALLPTLEKLYRQEPESVPFRY
PVDPQALGIPDYFEIVKKPMDLGTIRTNIQNGKYSDPWEYVDDVWLMFDNAWLYNRKTSR
VYRYCTKLSEVFEAEIDPVMQALGYCCGRKYTFNPQVLCCYGKQLCTIPRDAKYYSYQNS
LKEYGVASNRYTYCQKCFNDIQGDTVTLGDDPLQSQTQIKKDQFKEMKNDHLELEPFVDC
QECGRKQHQICVLWLDSIWPGGFVCDNCLKKKNSKRKENKFNAKRLPTTKLGVYIETRVN
NFLKKKEAGAGEVHIRVVSSSDKCVEVKPGMRRRFVEQNEMMNEFPYRAKALFAFEEVDG
IDVCFFGMHVQEYGSECPAPNTRRVYIAYLDSVHFFRPRQYRTAVYHEILLGYMDYVKQL
GYTMAHIWACPPSEGDDYIFHCHPTDQKIPKPKRLQEWYKKMLDKGMIERIIQDYKDILK
QAMEDKLGSAAELPYFEGDFWPNVLEESIKELDQEEEEKRKQAEAAEAAAAANLFSIEEN
EVSGDGKKKGQKKAKKSNKSKAAQRKNSKKSNEHQSGNDLSAKIYATMEKHKEVFFVIRL
HSAQSAASLAPIQDPDPLLTCDLMDGRDAFLTLARDKHFEFSSLRRAQFSTLSMLYELHN
QGQDKFVYTCNHCKTAVETRYHCTVCDDFDLCIVCKEKVGHQHKMEKLGFDIDDGSALAD
HKQANPQEARKQSIQRCIQSLVHACQCRDANCRLPSCQKMKRVVQHTKNCKRKTNANGGC
PICKQLIALCCYHARHCQEQKCPVPFCPNIKHKLKQQQSQQKFQQQQLLRRRVALMSRTS
APTALQGPPAVSGPTVVSGGVPVVGMSGVAVSQQVIPGQAGILPPGAGGMSPSTVAVPSP
VSGGAGAGGMGGMTSPHPHQSGIGMKPGGGHSPSPNVLQVVKQVQEEAARQQVSHGGGFG
KGVPMAPPVMNRPMGGAGPNQNVVNQLGGMGVGVGGVGGVGVGGVGGVGVNQLNSGGGGN
TPGGPIPGSGMNHLMSMDQWGGGGAGGGGGNPGGGNPQARYANNTGGMRQPNQMMQTNLI
PPQQQMMGSLGGPNQLGGGQMPVGGQHGGMGMGMGAPPMAGTVGGVRPTPGAGGGGGGAT
GGGLNNQQLAQIMQKIKNNPTNESNQHILTILKQNPQIMAAIIKQRQQSHQSQINAAAGG
GAPGPGGGALQQQQQQQAGNGPQNPQQQQQQQQQQQQQQQQQVMQQQQMQHMMNQQQGGG
GPQQMNPNQQQQQQQVNLMQQQQQQQVGPGGPGSGLPTRMPNMPNALGMLQSLPPNMSPG
VSAQGGMVPNQNWNKMRYMQMGQYPPPYPQRQRGPHMGGAGPGPGQQQFPGGGGGAGNFN
AGGAGGAGGVVGVGGVPGGAGSVPGGDQYSMANAAAASNMLQQQQGQVGVGVGVGVKPGP
GQQQQQMGVGMPPGMQQQQQQQQQQPLQQQQMMQVSMPNANAQNPSAVVGGPNAQVMGPP
TPHSLQQQLMQSARSSPPIRSPQPTPSPRSAPSPRAAPSASPRAQPSPHHVMSSHSPAPQ
GPPHDGMHNHGMHHQSPLPGVPQDVGVGVGVGVGVGVNVGNVGVGNAGGALPDASDQLTK
FVERL
NT seq 9918 nt NT seq  +upstreamnt  +downstreamnt
atgatggccgatcacttagacgaaccgccccaaaagcgggttaaaatggatccaacggac
atctcctactttctggaggagaacctgcctgatgagctggtgtcctcgaacagcggctgg
tcggatcagctgaccggcggagcaggcggtggcaatggaggtggcggcgcctccggtgtg
accacaaattccacatccggcccaaatcccggtggcggacccaacaaaccggcagcccaa
ggacctggctctggcactggcggagtcggtgttggagtcaatgtggccgtcggcggtgtt
gtcggcgtcggcgttgtgccttcccagatgaacggagccggcggcggcaacggatccgga
acgggcggcgacgacggcagtggcaacggctccggagcgggcaacagaatcagtcaaatg
cagcaccaccagcagctgcagcacctactccagcagcagcagcagggccagaagggcgcc
atggtggtgcccggaatgcagcagctgggcagcaagtcgcccaacctacagtcacccaac
cagggtggcatgcagcaggtggtgggcactcagatgggtatggtcaactcaatgcccatg
tcaatatcgaataatggcaacaatggcatgaacgccataccaggcatgaacaccattgcg
cagggcaatctgggaaacatggtgctgaccaacagcgttggcggcggcatgggcggcatg
gtcaatcatctcaagcagcagcctggcggcggcggcggtgggatgatcaatgccgtttcg
gtaccaggaggacctggatcaggagctggaggcgttggagctggcggcggtggtgccgtt
accacaaaccaaggcatgcatatgcagaacggcccgatgatgggccgaatggtggggcaa
cagcatatgctacgtggcccccatctcatgggtgccgctggaggagctggtgggcctgga
aatggacctggtggcggcggtccacgcatgcagaatcccaacatgcaaatgactcaactc
aacagtctgccgtacggagtgggtcagtatggtggtccaggcggtggcaacaatcctcag
cagcaacagcagcaacaactcctcgcccagcagatggcccaaagaggcggcgtcgtaccg
ggcatgccgcagggcaatcgacccgttggcacagtggtgcccatgtccacactcggtggc
gatggttcagtgcccgcggggcagctggtcagcggtaatcctcagcagcaacagatgctg
gcgcaacagcaaaccggagccatgggcccgcgtcctccgcaacccaatcagctgctcggt
catcccggacagcagcagcaacagcagccaggcacctcgcagcagcagcaacagggagtt
ggactcggaggcgcaggcgttgtggccaatgcaggaaccgttgctggcgtgccgacagga
gcaggcggcggagccggtggcgccgtacaagccagcggacctggtggcgccaatcgcgat
gtgcccgacgaccgtaagcgacagatccagcagcaactgatgctactcctccatgcacac
aagtgcaatcgcagggagaacctgaatccgaacagggaggtgtgcaacgtcaattactgc
aaggcgatgaaatcagtgctggcccacatgggcacttgcaaacagagcaaggactgcacc
atgcagcattgtgcctcctcgcgccaaatcctgttgcattacaagacgtgcacgaacagt
ggctgcgtgatttgctatcccttccggcagaatcattcggtttttcaaaatgctaatgtg
ccgccaggaggcgggccgcctggaattggaggtgcgcctccaggtggcggcggagcggct
ggtggagcggctggagcaggcggtaatcttcagcagcaacagcagcagcagcagcaacaa
cagcagcagcagcagcagcagcagcaaaaccagcagcccaatctgacgggtctggtggtg
gatggcaagcaaggacaacaggttgcaccaggaggtggtcagaacactgccatagttcta
ccccagcagcagggagcgggcggtgcaccgggtgcgccaaaaacgcctgcggacatggtg
caacaattgacccaacagcagcagcagcagcaacagcaggtgcaccagcagcaggttcag
caacaggaactccgtcgattcgatggcatgggccaagttggactatcgcccgtgccagct
ggtggtatgcagcagcagcagcagggtttgcctcctgtgattcgcatgcaaggcgctcag
ccggccgtcagggttctgggaccaggtggtcccggcggcccaagtggtcccaatgtactg
cccaacgatgttaacagcctgcatcaacaacagcagcagatgctccagcagcagcagcag
cagcaacagggccaaaatcgacgacgcggtggcctcgccaccatggtcgagcagcaacaa
caacagcagcagcagcagcagcaacaacaacagcagcaacccaatcccgcccagctgggt
ggcaacattccaacaccactctctgttaacgtcgcctttggcaatgccaatttcggtggt
gcggcagccggcggagccgtgggagccaatgataagcaacagctgaaggtggcccaagtg
catccgcagagccatggcgttggagcgggcggagcggcagcgggcgccggtgcgagtggt
ggtcaagtggcagctggttccagtgtactgatgccagccgataccacgggcagtggtaat
gcaggcaatcccaaccagaatgcaggcggtggagcaggaggcgccggcggtggcaatggc
ggaaactctggaccaccgggcgacaacgagaaagactggcgggaatcggtgaccgccgat
ctgcgcaaccacctcgtccacaaactggtgcaggccatcttccccacctcggatcccacg
accatgcaggacaagcggatgcataatctcgtttcctacgcggaaaaggtcgagaaggac
atgtacgaaatggccaagtccagatcggagtactatcacctgctggccgagaagatctac
aagatccaaaaggagctggaggagaagcgactgaagcgtaaagagcagcaccaacaaatg
ctgatgcagcagcagggcgttgcgaatccagtggctggaggagcggctggcggcgcaggc
agtgcagctggtggagcgggcggtgtagtcttgccccagcagcagcagcagcagcaacaa
cagcagcagcagcagcagggtcaacagccgctgcagagctgtatccatccaagcatcagt
ccaatgggcggtgtgatgcctccgcagcagctgcgtccacaaggaccacctggaatactg
ggccagcagactgcagcaggcctgggcgtcggcgtgggtgtcaccaacaacatggtgacc
atgcgcagtcattcgcccggtggcaacatgctcgccctgcagcaacaacagcgcatgcag
ttcccgcaacaacagcagcaacaaccgcccggttctggtgccggcaaaatgctggtaggc
ccaccaggacccagtcccggtggcatggtggtcaatcccgcgctctcgccttaccagacg
accaatgtgctcaccagtccggtgccgggacagcagcaacagcagcagttcatcaatgcg
aacggcggcactggtgccaatcctcagctgagcgagatgatgaagcagcgacacattcac
cagcagcagcaacagcaacagcaggtgcagcagcagggaatgttgttgccgcagtcgcca
ttcaacaatgccacacctctacaacaacaacagcagcagcagcagcaggcgactagcaac
agctttagctcaccaatgcagcaacagcagcagcagcaacaacagcagcagcagcagcag
cagcaaggtcagcaacagcaacaacagaagcccggcagtgtgctgaacaatatgccgccc
acgcccacgagtctggaagctctgaatgcgggagctggagcgccgttaacgggaggatct
gcctccaatgtgacggtttccgctccgagcccatcgcccggcttcctgtccaatggcccg
tcgattggcacgccctccaacaataataatagtagtagtgctaacaacaacccgccctcg
gtgagcagtctaatgcaacagccgctgagcaatcggccgggtacgcctccatatataccc
gcctccccagtgccggcgacaagtgcctccggattggcggcgagcagtacgcccgcatca
gcagcagccacatgtgcgagtagtggcagtgggagcaatagcagcagtggagccactgca
gcgggtgcaagttccacgtcatcatcttcctcggcgggctcgggtacaccactcagctcg
gtatcgactcctacatcggccacgatggccaccagcagcggtggtggtggtggtgctggc
ggtgcgggaggcggttcatccacaacgcccgctagcaatccactgctcctcatgtctgga
ggaacggcaggaggcggaacgggagcgacgaccaccacatcgacatcttcgagcagtcgc
atgatgagcagctccagcagtctctcctcacagatggctgccctggaggctgcggcgcga
gacaacgacgatgagacaccatcgccgtccggcgagaatacgaatggcagtggtggaagt
ggaaatgccggcggtatggcctccaagggcaagctggactccattaagcaagatgatgat
atcaagaaggagtttatggatgacagctgtggcggcaataacgatagctcgcaaatggat
tgctcgacgggcggtggcaagggcaagaatgtgaacaacgacggcaccagcatgatcaaa
atggagatcaagacggaggagggactcgatggcgaggtgaagatcaaaacggaggccatg
gatgtggacgaggctggtggatcgacagccggtgagcatcatggtgaaggtggcggcggc
agtggtgttggcggcggcaaggacaacatcaatggtgcgcacgacggtggatcggcaggc
ggtgctttggacataaaacccaagacggatacgaaaccactcgtacccgaaccgctggca
cccaatgcgggcgataagaaaaagaagtgccaattcaatcccgaagagttgcgcaccgct
ttgctgccgacgctggagaagctctacaggcaggagcccgagtccgtgccctttcgctac
ccagttgatccccaggcgctgggcatacccgattactttgagatcgtgaagaagcccatg
gacctgggcaccatacgcaccaacatacagaatggcaagtacagtgatccctgggagtat
gtggacgacgtttggctgatgttcgacaatgcctggctgtataatcgcaaaacatcgcgg
gtctatcgctattgcacaaagctttccgaagtctttgaggcggagatcgatcctgtgatg
caggcgctgggctattgctgcggcaggaagtacacattcaatccacaggtgctctgctgc
tacggcaagcagctgtgcacaattccgcgggatgcaaagtactacagctaccagaacagt
ctaaaggaatacggtgtcgcctcaaatagatacacctactgccaaaagtgctttaacgac
atccagggcgatacggtcacactgggcgacgatccactgcaatcgcaaacccaaatcaaa
aaggaccagttcaaggagatgaagaacgatcacctcgagctggagccgtttgtcgattgc
caggagtgcggacgcaaacagcatcagatctgcgtcctctggctggactccatttggccc
ggtggctttgtgtgcgacaactgtctgaagaagaagaactcgaagcggaaggagaacaag
ttcaatgcgaaacgcctgcccaccaccaagctgggcgtgtacatagagacgcgggtgaac
aacttcctcaagaagaaggaggctggtgccggcgaggtgcacatacgtgtggtcagctca
tcggacaagtgtgtggaggtgaagcccgggatgcggcgacgattcgtcgaacagaatgag
atgatgaacgagtttccttatcgggccaaagcactcttcgccttcgaggaggtggacggc
atcgatgtgtgcttctttggcatgcacgtccaggagtatggatccgagtgcccggcgccg
aatacgcgtcgtgtgtacattgcctatttggattccgttcatttcttccggccaagacag
taccgtacagcggtatatcacgaaatcctgctcggctacatggactacgtgaaacagctg
ggctacacaatggcccacatctgggcctgtccgccatccgagggcgatgactacatcttc
cactgccatcccacggaccagaagatacccaagcccaaacgcctgcaggagtggtacaag
aagatgcttgacaagggcatgatcgagcgcatcatacaggactacaaggatatcctcaag
caggcgatggaggacaaactgggctccgccgccgagttgccctactttgagggcgacttc
tggcccaatgtgctggaggagagcatcaaggaactggaccaggaggaggaggagaagcgc
aagcaggccgaggccgcggaagcagcagctgcggcaaatcttttctccatcgaggagaac
gaggtcagcggcgatggcaaaaagaagggccaaaagaaggccaagaagtcgaacaaatcg
aaagcggcgcagcgtaagaacagcaaaaagtccaatgaacatcaatcgggcaacgatctc
tccgccaagatatatgcgaccatggagaagcacaaggaggtattcttcgtcatccgtctg
cattcggcgcagtccgcagctagtttagcgcccatccaagatcccgatccgctgctcaca
tgcgatctgatggacggacgcgatgccttcctgaccctcgcccgcgacaagcactttgag
ttctcgtcgctccggcgcgcacagttctccacactgtccatgttgtatgagctgcataac
cagggtcaggacaagttcgtttacacctgcaatcactgcaagacggctgtggagacgcgc
taccactgcactgtttgtgatgactttgatctgtgtatcgtgtgcaaggagaaggttggc
catcagcacaagatggagaagctcggcttcgacatcgacgacggctctgcgctggcggat
cacaagcaggcaaatccgcaggaggcccgcaagcagtccatccagcgttgcatccaatcg
ctggtgcacgcctgccagtgtcgcgatgccaactgccgcctgccatcgtgccagaagatg
aagcgcgtcgtccagcacacaaagaactgcaagcgcaagaccaacgccaacggtggttgc
cccatttgcaagcagctcatcgccctctgttgctaccatgccaggcactgtcaggagcag
aagtgccccgtgccgttctgtcccaacatcaagcacaagctcaagcagcagcagtctcag
cagaaattccagcagcagcagttgctgcgtcgtcgcgtggcgctcatgtcgcgcacatcg
gcgccaacggctctgcaaggcccacctgcagtaagcggtccgaccgtcgtctctggcgga
gtgcccgtggtgggcatgtccggtgtggcagttagccaacaggtgatacccggccaggct
ggtatactgccgccaggagcgggtggcatgtcgccatctaccgtggcagtaccatcgccc
gtttcaggaggagctggcgccggtggtatgggcggaatgacctcaccacatccgcatcaa
tcgggcataggcatgaaaccaggtggcggtcactcgccgtcaccaaatgtcctacaagtg
gtgaagcaggtccaggaggaggcagcgcgccagcaggtttcgcatggcggtggcttcggc
aagggtgtacccatggcgccgcccgtgatgaatcgaccaatgggaggcgcaggacccaac
caaaatgttgtcaatcaactcggtggcatgggcgttggagttggtggtgtcggtggcgtt
ggcgtcggaggcgttggcggtgtgggtgtcaatcaactgaattcgggtggtggtggcaat
acaccaggtggcccgatacccggctccggaatgaatcacctgatgtccatggatcagtgg
ggcggtggcggagccggcggcggtggtggcaatcccggcggaggtaatccgcaagcgcgc
tatgccaacaacaccggcggcatgcgccagcccaaccagatgatgcaaacgaatctgata
ccgccgcagcaacagatgatgggcagtctgggcggacccaatcaactgggtggtggccaa
atgccagtcggcggacagcatggaggcatgggaatgggcatgggagcaccgccaatggcc
ggaactgttggcggtgtgcgtccaacccccggagcaggtggcggaggtggaggtgcaact
gggggcggtctaaataaccaacaactcgcccagatcatgcagaagatcaagaacaatccc
accaacgagagcaaccagcacatcctcaccatactgaaacagaatccgcagatcatggcg
gcgatcatcaagcagcgccagcagagccatcagtcgcaaatcaatgcggcggcgggcgga
ggagcacctggccccggtggtggagccttgcagcagcaacagcagcagcaggcgggcaac
ggaccgcagaatcctcaacagcagcagcagcagcaacaacaacagcagcagcagcagcag
caacaggtgatgcagcaacagcagatgcagcacatgatgaaccagcagcagggcggtggc
ggtccacagcagatgaatcccaaccagcagcagcaacagcagcaggtcaatctcatgcag
cagcagcagcagcaacaagttggacccggcggaccaggctcaggactgcccacgcgcatg
cccaacatgcccaatgccttgggcatgctgcagagccttccgcccaacatgtcgcccgga
gtttccgcccagggaggaatggtgcccaaccagaactggaacaagatgcgttacatgcag
atgggccagtacccgccaccgtatccgcagcgccagcgtggtccgcacatgggcggagcg
ggacccggtcccggccagcaacagttccccggtggcggcggtggtgcgggcaacttcaat
gcgggcggtgctggcggtgccggcggcgttgtcggtgtgggcggagtgcccggtggagct
ggttcggtgcccggtggcgatcagtactcgatggcgaatgcggcggccgcctccaatatg
ctgcaacagcagcagggacaggtgggggtcggcgtgggcgtcggtgtgaagccaggaccc
ggccaacagcaacagcagatgggcgtgggcatgccgccgggcatgcagcagcaacagcag
cagcagcaacaacagccgctgcagcagcagcaaatgatgcaggtgtccatgccgaatgcg
aatgcccagaatccgtcggcggtggtgggcggacccaatgcccaggtgatgggtccacca
acgccgcactctctgcaacagcagctaatgcaatcggcccgttcgtcgccgccaattcgc
tcgccgcagccaacgccatcgccacgttcggcgccgtcgccacgtgctgctccatccgcc
tcgccaagggcacagccctcgccgcaccatgtgatgagcagccattcgccggcgccgcag
ggaccaccgcatgatggtatgcacaatcatggcatgcatcatcagtcaccgctgccagga
gtgccgcaggatgtgggcgtgggcgtcggagtcggtgtcggcgttggcgttaacgttggt
aacgtgggcgtgggcaacgccggtggagccctgcccgacgcctccgaccagctgaccaag
tttgtggagagactctag

DBGET integrated database retrieval system