KEGG   Drosophila yakuba: Dyak_GE15459Help
Entry
Dyak_GE15459      CDS       T01068                                 

Gene name
dyak_GLEANR_16972
Definition
(RefSeq) GE15459 gene product from transcript GE15459-RC
  KO
K19603  
mitogen-activated protein kinase 15 [EC:2.7.11.24]
Organism
dya  Drosophila yakuba
Brite
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dyak_GE15459 (dyak_GLEANR_16972)
Protein kinases [BR:dya01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Dyak_GE15459 (dyak_GLEANR_16972)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 955 aa AA seqDB search
MANPTNIPAHERRIHELDQTVERIFDVRKRLGKGAYGIVWKATDRRQKNTVALKKIFDAF
RDETDAQRTYREVIFLRAFRHHPNIIRLVDVFKAANNLDFYLVFEFMESDLHNVIKKGDV
LKDIHKRFVMYQLINAIKYMHSGNVIHRDLKPSNILIDSKCRLKVADFGLARTLSSKRKA
DYDALDQEGMLTDYVATRWYRAPEILVASRSYTKGIDMWGLGCILGEMIRQKPLFQGTST
VNQIEKIVTALPDVTQRDIDSIGASFGSVLLSKKIHRDRRHSLDEMLRNCCDDAISLVKS
LLVLNPHLRLTAKAAIQHPYVSRFRTASADMELRVDIQPPLRDDVRYGVDQYRNNLYDMM
GRESSSSARTLSNATPSTPSNRDDSVKTVRVTTRTRTASVSQATTSPAERKKEPYSFEVT
QTRRKIKLLVSTSKTKAKETNRTENAVSHAHIAPPPAAVPAAAAPAPPAPRKSGEKTAQK
CRHNHVPIQRELAAVAAVARRKKSTWQSQAQTQGKFHAEAKAQVQALLLTQKINIDGSPA
RMRQDNHTHGQTQATVPPPMNRSLRKISQEKKPKEKPHKAEVSKPTVVTTYHRRERYLTA
EERMQRRQLEIQQKKEEEKVCQQQIEQEHELRVSQRRRMTENYRLMEAERDQLEEMAEQE
AQAKAYKEIARKVWKLTERKEDDSLPKDQKDDSTILNSCASKCYRERISHLELEMEKCKE
QLVDFVEEHRDLLNYDNLRYHLEKLQPLKKDSEHEDGDDGRPLPEGSGDPGSQSYENFLQ
EQEKERQRQVQEFLARDETNEYDNLNLDNAYRAKYYHLFRDITGGSSSPDSGRRDSGSEP
SPERDYSRDYADYFPNYSDLEEDWKEQAHPVEPRRQHERTEKSRRMKERLEDQRQRRDRL
LAQQKASRKQHEELGLHHKVHRHHHQHHAASGPRYDPMRLREHDIQEANFSTELI
NT seq 2868 nt NT seq  +upstreamnt  +downstreamnt
atggccaacccaaccaatattcccgctcacgagcgacgcatccatgagctggaccaaacc
gtagaacgcatcttcgatgtgcgaaagcgcctgggcaagggtgcctatggcatcgtttgg
aaggccacggataggcgacaaaagaacacggtggccctgaagaagatcttcgatgccttc
cgcgatgaaaccgatgcgcagcgcacctaccgtgaggtgatattcctgcgcgcctttcgc
caccatcccaacatcatccgactggtggatgtcttcaaggccgccaacaatttggatttt
tatttggtgttcgagttcatggaaagcgatctgcacaacgtgatcaagaagggcgatgtc
ctcaaggacattcacaagcgtttcgtcatgtaccagctgatcaatgccatcaagtacatg
cactcgggcaacgtcatccaccgggatctgaagcccagcaacatcctgatcgatagcaaa
tgcaggctcaaagtggccgactttggactggcccgaactctctcctcgaaacgcaaggcc
gactatgatgctttggaccaggagggcatgttgacggattatgtggccactcgttggtat
cgcgcccccgaaattctggtcgccagtcgcagctataccaaaggcatcgatatgtggggc
ctgggctgcattctgggcgagatgatcagacagaagcctctattccaaggcacaagcact
gtcaatcagattgagaaaatcgtgactgccctgccggatgtgacgcagcgggacatcgat
tcgattggagccagcttcggcagcgtcctgctgagcaagaagatccatcgcgaccgacgc
cattcgctggacgagatgttgaggaattgctgtgatgacgccatttcgctggtcaagtct
ctgctggtgctgaatccgcatctgcggctgaccgccaaggcggccattcagcatccgtat
gtgagtcgcttccggaccgcgtcggcggacatggagctccgcgtggacatccagccgccg
ctaagggacgatgtgcgctacggagtcgaccagtaccgcaacaatctgtacgacatgatg
ggtcgcgagtccagcagcagtgcccgcacgctcagcaatgccacaccatccacgccgtcc
aatcgggatgactccgtgaaaaccgtccgagtcacgacgcgaaccaggacagcgagtgtc
agccaagcgaccacaagcccggcggagagaaagaaggagccgtattccttcgaggtgacc
cagacgcgcaggaaaattaagctgctggtctccacatccaagacgaaggcaaaggagacc
aatcgcacggagaacgccgtttcgcatgcccatattgcgccgcctcctgcggctgttcct
gctgctgctgctcctgctccacctgctcctcgaaaatcaggagagaaaactgcgcaaaaa
tgccgccacaaccatgtgcccatccaacgggaattggctgccgtggcagcggtggctcgg
cgcaagaagagcacctggcaatcgcaggcgcagacgcaagggaaatttcatgccgaggca
aaggcccaagttcaggcgctgctcctcacacagaaaataaacatcgatggttcccccgcg
aggatgcgccaggataaccatacccatggccagacgcaggcgacagtgcccccaccaatg
aatcgttcgctgcgcaagataagccaagagaagaagcccaaggagaaaccccacaaggct
gaggtcagcaagcccactgttgtgacgacataccacagaagggagcggtacctcacggcc
gaggagaggatgcagcgccggcagctggagattcagcagaagaaggaggaggaaaaggtg
tgccagcagcagatcgaacaggaacacgagctgagggtgagccagcgcaggcggatgacc
gagaactatcgacttatggaggcggaacgcgatcagttggaggagatggccgagcaggag
gcgcaggccaaggcgtacaaggagatagccaggaaggtgtggaagctcaccgagaggaag
gaggatgactcgttgcccaaggatcagaaggatgattcgaccatcttaaactcatgcgct
agcaaatgctatcgcgaacggatcagtcacctggagctagagatggagaagtgcaaggag
cagttggtggactttgtcgaggagcatcgggatctgctgaactacgacaacttgcgctac
cacttggaaaagctgcagcccttaaagaaggacagtgagcacgaggatggggacgacggt
agaccactgccggagggcagtggtgatcccggctcccaaagctacgagaactttctccag
gagcaagaaaaggagcgacagcgccaggtgcaggagttcttggcccgcgacgagaccaat
gagtacgataacctcaatctggacaacgcctacagagccaagtactatcatctgtttagg
gatataacaggtggatcctcctcgccggacagtggaagacgcgattccggttcggagcca
tccccggagcgcgattactcgcgcgactatgccgactactttcccaactactccgacctg
gaggaggattggaaagaacaggcgcatccggtggagccgcggcggcagcacgaacgcaca
gaaaagtcacgccggatgaaggagcgcctggaggatcaacgtcaacgccgggaccgcctg
ctggcccagcagaaggccagccggaagcagcacgaagaactgggactccatcacaaggtg
caccgccatcatcaccagcaccacgcggccagtggacctcgctacgatcccatgcgtctc
agggagcacgacattcaggaggcgaacttctccacggagctcatctga

DBGET integrated database retrieval system