KEGG   Drosophila yakuba: Dyak_GE15563Help
Entry
Dyak_GE15563      CDS       T01068                                 

Definition
GE15563 gene product from transcript GE15563-RA
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
dya  Drosophila yakuba
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 925 aa AA seqDB search
MYRLEDTNSGGVMDKNKQKLSAYGSSGGSVAVDAAQGSGSGGGRQRHAPLYGRFVDAEDL
PATHRDVMHHHSSPSSSSEVRAMQARIPNHFREPASGPLRKLSVDLIKTYKHINEVYYAK
KKRRAQQTQGDDDSSNKKERKLYNDGYDDDNHDYIIKNGEKFLDRYEIDSLIGKGSFGQV
VKAYDHEEQCHVAIKIIKNKKPFLNQAQIEVKLLEMMNRADAENKYYIVKLKRHFMWRNH
LCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLSTPELNIIHCDLKPENI
LLCNPKRSAIKIVDFGSSCQLGQRIYHYIQSRFYRSPEVLLGIQYDLAIDMWSLGCILVE
MHTGEPLFSGCNEVDQMNKIVEVLGMPPKYLLDQAHKTRKFFDKIVADGSYVLKKNQNGR
KYKPPGSRKLHDILGVETGGPGGRRLDEPGHSVSDYLKFKDLILRMLDFDPKTRVTPYYA
LQHNFFKRTADEATNTSGAGATANAGAGGSGSSGAGGSSGGGGGLGTSNSSSGAVSSSSA
AAPTAATAAATAAGSSGSGSSVGGGSSAAQQQQAMPLPLPLPLPLPLPPLAGPGGASDGQ
CHGLLMHAAAANAMNNFSALSLQPTAHAPPSLANSHHSTNSLGSMNHISPGSSSCNNNIG
SSSSNNTRHSRLYGSNMVNMVGHHNSGSNSGSSSSSNNHNSISYPHAMECDPPQMPQMPP
PPPNGHGRMRVPAIMQLQPNSFAPSSVPYYGNMSSSSVAAAAAAAAAASHLMMTDSSVIS
ASAAGGGQGGGNPGQNPVPPSAAAFLFPSQPAGTLYGTSLGSLSDLPLPLPMPLPMSVPL
QLPPSSSTVSAGSAAVGSGGVGVGAGMGVGVVGQRRHISGPAAQVGISQSVGSGSSSATG
ASSSDASSSSPMVGVCVQQNPVVIH
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atgtatagactagaggatacgaatagcggcggcgttatggataagaataaacagaaactg
tccgcttatgggtccagcgggggcagcgtcgccgtcgacgccgcgcagggcagcggaagt
gggggcggaagacagcgccacgcccccctctacgggcgattcgtcgacgcagaggatctg
cctgccacgcaccgggatgtcatgcaccatcattctagtccctcgtcttcgtcggaggtg
cgcgccatgcaggcccggattcccaaccactttcgggagcccgcctcgggacctttgcgc
aagctgagtgtcgatctgataaagacctacaagcacatcaacgaggtttactatgcgaaa
aagaaacgtcgtgcccagcagacgcaaggagacgacgactcatctaacaaaaaggagcga
aaactttataacgacggctacgacgacgataatcacgattatataatcaagaatggcgaa
aagtttttggatcgctacgagatcgactctctgatcggcaaaggcagctttggccaggtg
gtgaaggcttacgaccacgaggagcagtgccacgtggcgatcaagataattaagaataag
aaaccgttcctaaaccaggcacagatcgaggtcaagttgctcgagatgatgaaccgggcg
gatgccgaaaacaaatactacatcgttaagctcaagcggcacttcatgtggcgcaaccac
ctgtgcctggtgttcgagctgctctcatacaacctgtacgacctgctgcggaacaccaac
ttccggggcgtttcgctgaacctcacgcgcaagttcgcccagcagctgtgcaccgcactg
ctcttcctcagcacccccgaactgaacataattcactgtgatttgaagcccgagaacatc
ctgctgtgcaacccgaagcgctcggcgatcaagatcgttgactttggcagctcctgccag
ttgggacagcggatctaccactacatccagtcgcgcttctaccgctcgccggaggtgctg
cttggcatccagtatgacctggccatcgatatgtggtcactgggctgcatcttggtcgag
atgcacaccggcgagccgctattctccggctgcaacgaggtggaccagatgaacaagatc
gttgaggtgctgggcatgccgcccaagtatctgctcgaccaggcgcacaagacccgcaag
ttctttgacaagatcgtggccgatggctcctatgtgctgaagaagaatcagaacggcagg
aagtacaagccaccaggatcccgcaagcttcacgacatcctcggagtggaaacaggcggc
ccagggggcaggcgtctcgatgagccaggccactccgtctcggactatctgaagttcaag
gatctgatactgcgcatgctcgactttgaccccaagacacgggtcacgccctactatgcc
ctgcagcacaacttcttcaagcgcacggcagacgaggcaaccaacacgagcggcgcgggc
gccacagcgaacgcaggagccggtggctccggatccagcggagctggaggctccagtggc
ggaggcggcggcctaggaacgagcaatagcagtagcggtgcggtctcctcatccagtgca
gcggctcctacggcggcgacagcagctgccactgccgcaggatcctccggttcgggttca
agtgtcggcgggggatcctccgcagcgcagcaacagcaggcgatgccgttgcccttgccg
cttcctttgccactgccgttgccaccactcgcgggtccaggcggtgcgtcagatggccaa
tgtcacggcctgcttatgcatgcggcggcggccaacgcgatgaacaacttctccgctctg
agcctgcagcctaccgcccatgcgccgccatcgctggccaatagccaccatagcaccaac
agcctgggcagcatgaatcacatcagtcccggcagcagcagctgcaacaacaacatcggc
agcagcagcagcaacaacacacgccacagtcgtctgtacggcagtaacatggtcaacatg
gtgggccaccacaacagcggcagcaacagcggcagcagcagcagcagcaacaaccacaac
agcatcagctatccgcacgccatggaatgtgatccgccgcagatgccgcaaatgccgcca
ccgccgcccaacggacatggcaggatgcgggtgccggcgataatgcagctgcaaccgaac
agctttgcgcccagttcggtgccctattacggcaacatgtcctcgtcgtcggtggctgcg
gcggcggcagcagctgctgctgcctcgcacctaatgatgaccgattcgagtgtgattagc
gcctcggcggcgggcggtggccagggcggcgggaatcccggccagaatccggttccgccg
tcagctgccgcctttctcttcccatctcagcccgccggaacgctctatggaacgtcgctc
ggctcgctgagcgacctgccactgccgctgcctatgccactgcccatgtccgtgcccctg
caactaccgccctcgtcgtcaaccgtctccgcaggttcagcagcagttggatctggagga
gtgggtgtgggtgcgggtatgggagtcggtgtggttggtcagaggcggcacatcagcgga
cccgccgcacaggtgggcatctctcaaagtgtcggcagtggcagcagctcggccaccgga
gccagcagcagcgacgcctcctcgtcgtcgcccatggtgggcgtttgtgttcaacagaat
cctgtagttatacattag

DBGET integrated database retrieval system