KEGG   Drosophila yakuba: Dyak_GE15575Help
Entry
Dyak_GE15575      CDS       T01068                                 

Definition
GE15575 gene product from transcript GE15575-RA
Orthology
K08865  
PDZ-binding kinase [EC:2.7.12.2]
Organism
dya  Drosophila yakuba
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 390 aa AA seqDB search
MDTPRRKLRNLHMENVQNSSTPINVPPSPMLKTLGHGTGIRVYRLDRSPRLGEIRSPWAV
KRITQNMRVKKDTLFNERIVHEADILRKLKHPNIVGFRGVVTNDEGINTLALEMCTTSLG
SILEERHDEDLGPLPAKNTYKMIMDVALALDFLHNEARLMHGDLKSFNVLVKGEFEICKL
CDFGVSLPLDEHGEVNFLKNPGLRYVGTSLWCAPEVIDEVDVIDSKAEIFSFGLVIYETL
ALVPPHTLELDAALGEDMDNSHDLPTDTEKLQRKQLDFSSDERKNGLPTAMEEHTDNDMS
HDDDDEEEEEEEEDDDTKENDISDFTLNNLHSAYGTRPPLPVAFQLSDDYNCIVELFYLC
TNALSEDRPAAKTIWQCLENNAANVATGSD
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggacacgccacgccgcaagctgagaaatttgcacatggagaatgtccagaacagcagc
acgcccatcaacgtgccgccctcgccgatgctgaagaccctgggccacggcactggtatc
cgggtctaccgcttggaccgctccccccgtctcggcgaaatccgctcgccatgggccgtc
aagcggatcacgcagaacatgcgggtgaagaaggacacgctcttcaacgagcggattgtc
cacgaggccgatatcctacgcaaactgaagcatccaaatatcgtgggcttccgaggcgtt
gtcaccaatgacgagggcatcaacacattggcactcgaaatgtgcaccacttcactgggc
tccatactcgaggagcgtcacgacgaggatctgggcccgttgccggccaaaaatacctat
aagatgatcatggacgtggcactggcactagattttcttcacaacgaagcgcgtctcatg
cacggcgacctcaagtcctttaatgtcctggtcaagggcgagtttgagatctgtaagctg
tgcgattttggagtctctcttccgctggacgaacatggcgaggttaatttcctaaagaat
cccggactgcgctatgtgggaactagcctctggtgcgccccggaggtaatagacgaagtg
gatgttattgacagcaaggcagaaattttcagctttggcctggttatctacgaaaccctt
gcgctggtgcctccacataccttggagctcgatgccgcacttggcgaggatatggacaat
tcccacgatttacccaccgacacggagaagctgcagcgcaaacagctggacttctccagc
gatgaaaggaaaaacggactacctactgcaatggaagaacatacagacaacgatatgagt
cacgatgatgacgacgaggaggaggaggaggaagaagaagatgatgacaccaaggagaac
gacatctccgactttacactgaacaaccttcattccgcctatggtacacgcccaccattg
cccgtggcctttcagctcagcgacgattacaactgcattgtggagctgttttatctgtgc
acaaatgctctgagcgaggatcgaccagcggccaagaccatttggcagtgcctggagaac
aatgccgcaaatgttgcgactggaagcgattag

DBGET integrated database retrieval system