KEGG   Drosophila yakuba: Dyak_GE15685Help
Entry
Dyak_GE15685      CDS       T01068                                 

Gene name
dyak_GLEANR_17177
Definition
(RefSeq) GE15685 gene product from transcript GE15685-RA
  KO
K11851  
ubiquitin carboxyl-terminal hydrolase 30 [EC:3.4.19.12]
Organism
dya  Drosophila yakuba
Brite
Enzymes [BR:dya01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dyak_GE15685 (dyak_GLEANR_17177)
Peptidases [BR:dya01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dyak_GE15685 (dyak_GLEANR_17177)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 558 aa AA seqDB search
MESEKILMAAGVTVAAVVGAFVFWGPSGSRLRQRRGQIAGLHNFGRTCFLNTLLQAMAAC
PQFIAWLQLYNNASPDRKSLITSMLNTLEVVNGTHATLRGDPHSPGAVLRALNALGWVIP
QEEHDAHELFHVLLSSLEEEAIRPQPLGCLSDALPTDNDDNSSFAGTATPVGGFRPISSM
AAGLGASQRIGDQPNRPSSAMLTDFLNMEYDESTSLQRLVRSEAHTPDSPASVCERDGND
RLGSLLLDAVSPGTPFGFPIISDPDSLATPTLGGERLSRPRLPQSQQQQEEGLNRRVSSS
CRSLERLHRGPGRVSIWSNMMPSQVAHPFQGAMGAQIVCNGCGSKSAVRYDKFDSITLNL
PPQRRTGLSLGHLLSEYITSEDLSDVKCDSCNETTTHTKSVTFAKLPACLCIHVARTVWL
PTGQVCKRQDYVHFPESLSMAPYSFVQPHLNSQAGTPWGSTMSLYSSSLPMNNGVGGGEG
FGTMFPKNLYRLLAVVVHSGEANSGHFVTYRRGSLRNAHRWFYTSDTIVREVSIDEVLSV
PAYLLFYDRGQQRQLNLR
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggagagcgagaagattctaatggccgccggagtgacggtggccgccgtggtgggagcc
ttcgttttctggggtccttcgggttcccggttgcgccaacgacgcggccaaatagccgga
cttcacaactttggacggacctgcttcctgaacactctgctgcaggcgatggccgcctgt
ccccagttcattgcctggctgcaattgtacaacaacgcatcgccggatcgaaaaagcttg
atcacctcgatgctgaacaccctggaggtggtcaatggcactcatgccaccctgcgcggt
gatccccattccccgggagccgttcttcgtgctctgaatgccctgggctgggtgattcca
caggaggagcacgacgcccacgagctgttccacgtgctattgtcctccctggaggaggag
gccatacgaccacagcccctcggctgtctgtcggatgctctgcccacggataacgatgat
aacagcagttttgcgggcacagccacgccggtgggcggctttcgaccgattagctccatg
gcagcgggtctgggcgccagccagaggatcggagatcaacccaacaggccctccagtgcc
atgctcactgatttcttgaacatggagtacgatgagagcaccagtttgcagcgtctggtg
cgttcggaggcccacacaccggattcgcccgcttctgtttgcgaacgtgacggaaacgat
cgcctgggatccctgctcctagatgccgtttcgccaggtacaccctttggctttccgata
atcagtgatccggactccttggccacgcctacgttgggcggcgagcgtttgtcgcgaccg
cgcctaccacaatcccaacagcagcaggaggagggcctaaatcgccgagtttccagctcc
tgtcgatccctggagcgtctgcatcgtggacccggtcgagtgtccatctggtcgaacatg
atgcccagccaggtggcgcatccgtttcagggcgccatgggcgcacagatcgtgtgcaat
ggctgcggctccaaatcggccgtgcgttacgataagttcgatagcatcacgcttaatctg
ccgccgcaacgcagaaccggcttgagtttgggccaccttctcagcgagtacatcacatcg
gaggatctgagcgatgtcaagtgcgattcctgcaacgagaccaccacgcacaccaagtcg
gttacgttcgccaaactcccggcctgcctgtgcatccatgtggcgcgaacggtgtggctg
ccaactggacaggtgtgcaagcggcaggactacgtgcacttccccgagagcctctccatg
gctccctacagctttgtgcagccgcatctcaacagtcaggctggcactccctggggctcg
acgatgtccctgtattcctccagcctgccgatgaacaatggcgtgggtggtggcgagggc
tttggcacaatgttccccaagaatctttaccggctgctggcggtggtggtgcactccgga
gaggcgaatagcggccactttgttacctacaggcgtggctcgttgcggaatgcccatcgg
tggttttacacatcggatacgattgtgcgggaggtgagcatcgacgaggtgttgagcgtg
cccgcctatctactattctacgatcgtggccagcagaggcagctgaacctgcgctag

DBGET integrated database retrieval system