KEGG   Drosophila yakuba: Dyak_GE15754Help
Entry
Dyak_GE15754      CDS       T01068                                 

Definition
GE15754 gene product from transcript GE15754-RA
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
dya  Drosophila yakuba
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dyak_GE15754
Enzymes [BR:dya01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     Dyak_GE15754
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 663 aa AA seqDB search
MLKMPLQLQLSSQDGIWPTRSRRLHHQQLAYQHQDQEQQEQKQQHKQKQNGVHQGRSPTF
MPVMLLLLMATLLTRPLSAFSNRLSDTKLHEIYLDDKEIKLSWMVDWYKQEVLFHLQNAF
NEQHRWFYLGFSKRGSLADADICFFENQNGFFNAVTDTYTSPDGRWVRRDYQQDCEVFKM
DEFTLAFRRKFDTCDPLDLRLHEGTMYVVWARGETELALEDHQFALPNVTAPHEAGVKML
QLLRADKILIPETELDHMEITLQEAPIPSQETTYWCHVQRLEGNLRRRHHIVQFEPLIRT
PGIVHHMEVFHCEAGEHDEIPLYNGDCEQMPPRAKVCSKVMVLWAMGAGTFTYPPEAGLP
IGGPGFNPYVRLEVHFNNPEKQSGLVDNSGFRIKMSKTLRQYDAAVMELGLEYTDKMAIP
PGQTAFPLSGYCVADCSRAALPATGILGGGSQLLSYLRGVRVLTRHFRGEQELREVNRDD
FYSNHFQEMRTLHYKPRVLPGDALVTTCYYNTKDDKTAALGGFSISDEMCVNYIHYYPAT
KLEVCKSSVSEETLENYFIYMKRTEHQHGVHLNGARSSNYRSIEWSQPRIDQLYTMYMQE
PLSMQCNRSDGTRFEGRSSWEGVAATPVQIRIPIHRKLCPNYNPLWLKPLEKGECDLLGE
CIY
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaaatgccgctgcagctgcagctgagcagtcaggatggcatttggccaaccaga
tctcgacgtctccaccaccagcaactggcttatcagcatcaggaccaagagcagcaggag
cagaagcagcagcataaacaaaagcaaaatggagtgcaccaaggacgttcgccgacattc
atgccagtgatgctgctcctcctgatggccacactcctcacgcgcccactgagcgccttc
tccaaccgattatcggacacaaagctgcacgagatctacctggacgacaaggagatcaag
ctgagctggatggtggactggtacaagcaggaggtgctcttccacttgcagaacgccttc
aacgagcagcaccgctggttctatctgggcttctccaaacgcggcagcttggcggatgcg
gacatttgcttctttgagaatcagaatggcttcttcaatgcggtcaccgatacgtacacc
agtcccgatggacgctgggtgaggcgggattaccagcaggactgcgaggtcttcaaaatg
gatgagttcacgctggcctttaggcgcaagtttgacacctgcgatcccttggatctgcga
cttcatgagggcaccatgtatgtggtgtgggcacgtggtgaaacggaactggccctggag
gatcaccagttcgccctgcccaatgtgacggctccgcacgaggcgggcgttaagatgctg
cagttgctccgcgccgacaagatactgatacccgaaaccgagctggatcacatggagatt
acgctgcaggaggcgccgatacccagccaggagaccacctactggtgtcacgttcagcga
ctggagggcaatctacggcgtcgccatcacatcgtccaatttgagccgctcatccgaacg
ccgggcattgtgcaccacatggaggtgttccactgcgaggccggcgagcacgatgagatt
cccctgtacaatggcgactgcgaacagatgccgccgcgggccaaggtctgctccaaggtg
atggtcctgtgggccatgggcgccggcaccttcacctatcctccggaagctggtctgccc
atcggtggacccggcttcaatccctacgttcgcctggaggttcatttcaataatccggag
aagcagtctggcttggtggacaactccggcttccgcatcaagatgtcgaagacactgcgt
cagtatgacgccgccgtcatggaactgggcttggagtacaccgacaagatggccattccg
cccggccaaacggcattcccgctaagcggctactgtgtggcggattgctcacgagccgct
ctgccggcgacgggcatcttgggggggggctcccaactgctttcctatctacgtggcgtc
cgcgtcctcacccgtcactttcgcggcgagcaggagctgcgcgaggtgaatcgcgatgac
ttctactcgaatcacttccaggagatgcgcaccttgcactacaagccacgtgtcctgccc
ggtgacgctctggtgaccacttgctactacaacaccaaggatgacaagaccgccgccctc
ggcggtttctccatcagcgacgagatgtgcgtcaactacatccactactatccggccacc
aagctggaggtctgcaagagttccgtttccgaggagacgctcgagaactacttcatttac
atgaagcgcacggagcatcagcacggcgtgcatctgaatggagccaggtcgtccaattac
cggagcatcgagtggagccagccgcggatcgatcagctgtacaccatgtacatgcaggag
ccgctgagcatgcagtgcaacaggtccgatggcactcgcttcgaggggcgctccagctgg
gagggcgtggctgcgacgccagtccaaatccgcatacccattcaccgcaaactgtgcccc
aactacaatccgctgtggctgaagccattggagaagggcgagtgcgatttgctgggggag
tgcatctattag

DBGET integrated database retrieval system