KEGG   Drosophila yakuba: Dyak_GE15754Help
Entry
Dyak_GE15754      CDS       T01068                                 

Definition
GE15754 gene product from transcript GE15754-RA
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
dya  Drosophila yakuba
Pathway
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:dya00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 663 aa AA seqDB search
MLKMPLQLQLSSQDGIWPTRSRRLHHQQLAYQHQDQEQQEQKQQHKQKQNGVHQGRSPTF
MPVMLLLLMATLLTRPLSAFSNRLSDTKLHEIYLDDKEIKLSWMVDWYKQEVLFHLQNAF
NEQHRWFYLGFSKRGSLADADICFFENQNGFFNAVTDTYTSPDGRWVRRDYQQDCEVFKM
DEFTLAFRRKFDTCDPLDLRLHEGTMYVVWARGETELALEDHQFALPNVTAPHEAGVKML
QLLRADKILIPETELDHMEITLQEAPIPSQETTYWCHVQRLEGNLRRRHHIVQFEPLIRT
PGIVHHMEVFHCEAGEHDEIPLYNGDCEQMPPRAKVCSKVMVLWAMGAGTFTYPPEAGLP
IGGPGFNPYVRLEVHFNNPEKQSGLVDNSGFRIKMSKTLRQYDAAVMELGLEYTDKMAIP
PGQTAFPLSGYCVADCSRAALPATGILGGGSQLLSYLRGVRVLTRHFRGEQELREVNRDD
FYSNHFQEMRTLHYKPRVLPGDALVTTCYYNTKDDKTAALGGFSISDEMCVNYIHYYPAT
KLEVCKSSVSEETLENYFIYMKRTEHQHGVHLNGARSSNYRSIEWSQPRIDQLYTMYMQE
PLSMQCNRSDGTRFEGRSSWEGVAATPVQIRIPIHRKLCPNYNPLWLKPLEKGECDLLGE
CIY
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaaatgccgctgcagctgcagctgagcagtcaggatggcatttggccaaccaga
tctcgacgtctccaccaccagcaactggcttatcagcatcaggaccaagagcagcaggag
cagaagcagcagcataaacaaaagcaaaatggagtgcaccaaggacgttcgccgacattc
atgccagtgatgctgctcctcctgatggccacactcctcacgcgcccactgagcgccttc
tccaaccgattatcggacacaaagctgcacgagatctacctggacgacaaggagatcaag
ctgagctggatggtggactggtacaagcaggaggtgctcttccacttgcagaacgccttc
aacgagcagcaccgctggttctatctgggcttctccaaacgcggcagcttggcggatgcg
gacatttgcttctttgagaatcagaatggcttcttcaatgcggtcaccgatacgtacacc
agtcccgatggacgctgggtgaggcgggattaccagcaggactgcgaggtcttcaaaatg
gatgagttcacgctggcctttaggcgcaagtttgacacctgcgatcccttggatctgcga
cttcatgagggcaccatgtatgtggtgtgggcacgtggtgaaacggaactggccctggag
gatcaccagttcgccctgcccaatgtgacggctccgcacgaggcgggcgttaagatgctg
cagttgctccgcgccgacaagatactgatacccgaaaccgagctggatcacatggagatt
acgctgcaggaggcgccgatacccagccaggagaccacctactggtgtcacgttcagcga
ctggagggcaatctacggcgtcgccatcacatcgtccaatttgagccgctcatccgaacg
ccgggcattgtgcaccacatggaggtgttccactgcgaggccggcgagcacgatgagatt
cccctgtacaatggcgactgcgaacagatgccgccgcgggccaaggtctgctccaaggtg
atggtcctgtgggccatgggcgccggcaccttcacctatcctccggaagctggtctgccc
atcggtggacccggcttcaatccctacgttcgcctggaggttcatttcaataatccggag
aagcagtctggcttggtggacaactccggcttccgcatcaagatgtcgaagacactgcgt
cagtatgacgccgccgtcatggaactgggcttggagtacaccgacaagatggccattccg
cccggccaaacggcattcccgctaagcggctactgtgtggcggattgctcacgagccgct
ctgccggcgacgggcatcttgggggggggctcccaactgctttcctatctacgtggcgtc
cgcgtcctcacccgtcactttcgcggcgagcaggagctgcgcgaggtgaatcgcgatgac
ttctactcgaatcacttccaggagatgcgcaccttgcactacaagccacgtgtcctgccc
ggtgacgctctggtgaccacttgctactacaacaccaaggatgacaagaccgccgccctc
ggcggtttctccatcagcgacgagatgtgcgtcaactacatccactactatccggccacc
aagctggaggtctgcaagagttccgtttccgaggagacgctcgagaactacttcatttac
atgaagcgcacggagcatcagcacggcgtgcatctgaatggagccaggtcgtccaattac
cggagcatcgagtggagccagccgcggatcgatcagctgtacaccatgtacatgcaggag
ccgctgagcatgcagtgcaacaggtccgatggcactcgcttcgaggggcgctccagctgg
gagggcgtggctgcgacgccagtccaaatccgcatacccattcaccgcaaactgtgcccc
aactacaatccgctgtggctgaagccattggagaagggcgagtgcgatttgctgggggag
tgcatctattag

DBGET integrated database retrieval system