KEGG   Drosophila yakuba: Dyak_GE15771Help
Entry
Dyak_GE15771      CDS       T01068                                 

Definition
GE15771 gene product from transcript GE15771-RA
Orthology
K06091  
MAGUK p55 subfamily member 5
Organism
dya  Drosophila yakuba
Pathway
Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dya00001]
 Environmental Information Processing
  Signal transduction
   04391 Hippo signaling pathway -fly
    Dyak_GE15771
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 1719 aa AA seqDB search
MQANSSRSNLSAQSSGTPSASTISSSQGKQQVVELSGYVIILVENVEGKIKLYGSPPDRD
NLEVGDEILEVNGLTLENISRTEVIRHIHDCIKSCTICLRVRKKNDSRLAWDIGNSVQDA
FVIAVEEHARERLQRLAALNRVTPVDITQLSKKLLEDVIVHQASDVHSYSTSASAAIASS
SNRTQQHHQLLSAAYELQQQQQQQQQQLQLQQQQQQQNSPTSSISIGRTELLLGDQSLRQ
DPRGNRRRSGSSIVVLDGDDLKPCLPDDYISGQHHLNHQQQLQLQQQLQQQHPLQQQHYR
THSGDIREIDQEMLTMLSVNQDNGPHREMAVDCPDTFIARNKTPPRYPPPRPPQKHKKST
TNTNTTTTTITAMTNNDHANKMLIVAYHSSHQHEQLQQQQQQPPPPHHEQQQQHPSKTTT
TTIALDVATQNMYNQKQQNKLEQIENYENCLQSEQHEQHEQLEQQKQHQVTTAVAVATQV
AQQQTPSHKLQATLSSDPNGNSNSNSNTVGGSSSSNNSSITDDFLCVVDGLYQGRKDSAS
PSSSAFDEVMSKHTLDSFGSIAYRHLHQQHQATSNGNSSNTSNTNSNGNSNGNNTSNNTA
ASTNKTATVSKTGVSSSNSNSNSLNSSNSSMHTSSSSSGHSSNIASATSSSSSSGTSSST
VPDDLSLAPPGYEVSQQQQQQQQQKQQHLVASPVTMLLPPMAKHRELPVDVPDSFIEMVK
TTPRYPPPAHLSSRGSLLSNGSASTAHTTLSSMGVSPSPVTATAAAAAAASAAATTSATT
LACATTAVAVAAAAAAVSGVADGDARRVVDELNGNAKPVPPPRDHLRVEKDGRLVNCSPA
PQLPDRRAPGNASSGSSGAAMHPLQQQQQQQQQIAQIVEPTLEQLDSIKKYQMVVSTLHI
TLENNGNVAAGQPAVVAVAAAANVVGAARTPTKFAVLSAQQLQLQQQQLQQQQQQQQNEK
ENHMNNNNNSDYCDMNGNGVGMGNAGHVGGGLVGTGSLSPQSPDQYVGSPVSSTTTATAT
PQRTASALRRGIQIQRSSTRLRQQQEQLRRRREEEERIAQQNEFLRNSLRGSRKLKALQD
TATPGKAIAQQQQQQATLATQVVGVENEAYLPDEDQPQAEQIDGYGELIAALTRLQNQLS
KSGLSTLAGRVSAAHSVLASASVAHVLAARTAVLQRRRSRVSGPLHHNALGLQKDIVELL
TQSNTAAAIELGNLLTSHEMEGLLLAHDRIANHTDGTPSPTPTPTPAIGAATGSTISSPV
AGPKRNLGMVVPPPVVPPPLAQRGAMPLPRGESPPPVPMPPLATIPMSMPVNLPMSACFG
TLNDQNDNIRIIQIEKSTEPLGATVRNEGEAVVIGRIVRGLGGAHRDTAVLHVRAHFDYD
PEDDLYIPCRELGISFQKGDVLHVISREDPNWWQAYREGEEDQTLAGLIPSQSFQHQRET
MKLAIAEEAGLARSRGKDGSGSKGATLLCARKGRKKKKKASSEAGYPLYATTAPDETDPE
EILTYEEVALYYPRATHKRPIVLIGPPNIGRHELRQRLMADSERFSAAVPHTSRARREGE
VPGVDYHFITRQAFEADILARRFVEHGEYEKAYYGTSLEAIRTVVASGKICVLNLHPQSL
KLLRASDLKPYVVLVAPPSLDKLRQKKLRNGEPFKEEELKDIIATARDMEARWGHLFDMI
IINNDTERAYHQLLAEINSLEREPQWVPAQWVHNNRDES
NT seq 5160 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcgaacagcagccgctccaacttaagcgcacaatcctcgggcacgccgtcggcc
tcaacgatctcctcgtcccagggcaagcaacaagttgtcgaactatcgggctatgtcatc
atactcgtcgaaaatgtggagggtaaaattaaactatacggctcaccgcccgatcgcgat
aatctggaagtgggcgatgagatactcgaggtcaatggcctgaccctggagaatatatcg
cgcacggaggtcattcgccacatacacgactgcatcaaatcctgcaccatttgtctgcgt
gtgcgaaagaagaatgattcacgactggcctgggatattggcaactcggtgcaggacgcc
ttcgtcatcgccgtcgaggagcacgcccgcgaacgtctgcagagattggcggccttgaac
cgggtcacgcccgtcgacatcacccagctgtccaaaaagttactagaagacgtcatagtc
catcaagccagtgatgtgcattcatacagcacgagtgcatcagcagcgatcgccagcagc
agcaacagaacacagcagcatcatcagttgctgagtgccgcctacgagttgcagcaacaa
cagcaacagcaacagcagcagttgcaactgcaacagcagcagcagcaacagaacagtccc
acaagtagcatatcaattggaagaactgaacttttactgggcgatcagagtttgcggcag
gatcccagagggaatcgccggcgctccggatcgagcattgttgtgctggacggcgacgat
ttgaagccatgtctgccggatgactacataagcggccagcaccatctgaatcaccagcag
cagttgcaactgcagcagcagctgcagcagcaacatccgctccagcagcaacactatcgc
acgcactcgggcgacatcagggagattgaccaggaaatgctgaccatgctgtccgtgaac
caagataacggtccacaccgtgagatggccgtcgattgtccggacacgttcatcgcacgc
aacaagacgccaccccgatatccgccaccccgtccaccacagaaacacaagaaaagcacc
accaacaccaacaccaccaccaccacaatcacagctatgactaacaatgatcatgctaac
aaaatgttaattgttgcatatcattcttcacatcaacatgaacaactacaacaacaacaa
caacaaccaccaccaccacatcatgaacaacaacaacaacacccatcaaaaacaacaaca
actacaattgcactcgatgtggccacacaaaatatgtacaatcaaaaacaacaaaacaaa
ttggaacaaatcgaaaactatgaaaattgcctgcaatcggaacaacacgaacaacacgaa
caacttgagcaacagaagcaacatcaagtgacaaccgcagtggcagtggcaacacaggtg
gcacaacaacagacgcccagccacaagttgcaggcaacattgagcagcgatccgaatggc
aacagcaacagcaacagcaacaccgttggcggcagcagcagcagcaacaacagcagcatc
acggatgacttcctctgcgttgtggatggcctgtatcagggacgcaaggactcggcctcg
ccctcatcgagtgccttcgatgaggtgatgagcaaacacaccctggactccttcggcagc
atcgcctatcgtcacctgcaccagcagcatcaggcgacgagcaacggcaacagcagcaac
acgagcaacacaaacagcaatggcaacagcaatggcaacaacacaagcaacaatacagct
gcttcgacaaacaaaacagcaacggttagcaaaacaggcgtgagcagcagcaacagcaac
agcaactcactgaacagcagcaacagctcgatgcacacgagcagcagcagcagcggccac
agcagcaacatagccagtgccacatcatcatcatcatcatccggcaccagcagctcaact
gtgcccgatgacctgagcctggcgccacccggttacgaggtgagccagcagcagcagcag
caacagcaacagaagcagcaacatttggttgcctcacccgtgacaatgttgctgccaccg
atggccaagcatcgcgagttgcccgtggatgtgccggacagctttatcgagatggtcaag
acaacgccaagatatccgccaccagctcacctttcctcacgcggatcgctgttgtcgaac
ggcagcgcctccaccgcccacaccacgctctcctcgatgggcgtgtcgccttcgcctgtc
actgcaacagcagcagcagcagcagcagcatcagcagcagcaacaacatctgcaacaaca
ttagcatgtgcaaccactgctgttgctgttgctgctgctgctgctgcggtttctggtgtt
gctgacggcgatgcgaggcgggtggtcgatgagctcaatgggaatgcgaagcccgtgcca
ccgccacgagatcatctgcgggtggagaaggacgggcggctggtcaactgctcacccgca
ccacagttgccggatcgaagggcgccggggaatgcgagcagcggcagcagcggcgcagca
atgcatccgctgcagcagcagcagcagcagcagcagcagatcgcacagattgtggagccc
acgttggagcagctggacagcatcaagaagtaccagatggtcgtatccactttgcacata
acgctggagaacaacggcaatgttgctgccgggcagccagcagttgttgcagttgctgct
gctgctaatgtcgttggggcggcaagaacgcccaccaagtttgctgtgctgtcggcgcag
cagctgcaactgcagcagcaacaactgcagcaacaacagcagcagcagcagaacgagaag
gagaaccatatgaacaataataacaacagcgactattgtgatatgaatggcaatggagtt
ggaatgggaaacgctggccatgttggtggtggcttggttggcacgggatctctatcgccc
caatcccccgaccaatatgtcggctcacctgtatcatccactaccactgccactgccacg
ccccaacgcaccgcctccgccctgcgtcgcggcattcaaattcagcgatcctcgacgcgt
ttgcgacaacaacaggagcaactgcgccgacgacgcgaggaggaggagcgcatagcgcag
caaaatgaattcctgcggaacagtcttcgtggctcccggaagctgaaggcgctccaggat
acggccacgccaggaaaagcgattgcccagcagcagcagcagcaggcaacgctggccacc
caggtggttggcgtcgagaatgaggcatatctgcccgacgaggaccagccgcaggcggaa
cagattgatggctatggcgagctgatagccgccctcacccgcctgcaaaaccagctgagc
aagagcggattgagcacgctggcgggtcgcgtttccgctgctcacagtgtcctggccagc
gccagtgtggcccatgtcctggccgctcgcaccgccgtcctccagcgacgacgttcccgc
gtctctggtccactgcatcacaatgccctgggattgcagaaggacattgtggagctgcta
acgcaatcgaatacggcggcggccatcgagctgggcaacctgctgaccagccatgaaatg
gagggtctcctcctggcccacgatcgcattgccaatcacacggatggcacgccctcgcct
acacccacgcccactccggccattggagcggcgacgggatccacaatcagcagtccggtg
gctggacccaagagaaacctaggcatggtggtgccgccgcccgtggtgccacccccactg
gcgcaacgtggagcaatgccactgccgcgcggagagtcgccaccgccggtgcccatgcca
ccactggccacaatacccatgtccatgcccgtcaatctgccaatgagtgcgtgctttggc
acgctaaacgatcagaacgacaacatcaggatcatccaaatcgaaaagtccacggagccg
ctgggcgccacggtgcgcaacgagggtgaggcggtggtcatcggccggattgtgcgtgga
ttgggtggagcacatcgcgataccgccgtgttgcacgtccgggcgcactttgactacgat
ccggaggacgatctgtatataccctgccgggagctgggcatcagcttccagaagggcgat
gtgctgcacgtgatcagtcgcgaggatcccaactggtggcaggcgtatcgcgagggcgag
gaggaccagacgctggccggtcttattcctagtcagtcgttccagcatcagcgcgagacc
atgaagctggccattgcggaggaggcgggactggcgcgatcccgcggcaaggacggatcg
ggcagcaaaggagccacgctcctctgtgcgcgcaagggtcgcaaaaagaagaagaaggcc
agctccgaggcgggatatcccttgtacgccaccacggcgccggatgaaacagatccggag
gagatactcacctacgaggaggtggctttgtactatccccgcgctacccacaagcggccc
atcgtcctcatcggcccgcccaacattggaagacatgagttgcgccaacgcctgatggcc
gactcggagcgtttctccgccgcagtgccacacacatcacgagcccgcagggagggcgaa
gtgcccggagtggactaccacttcatcacgcgacaagccttcgaggcggacattttggcg
cgccgctttgtggagcacggtgaatacgagaaggcctactacggcacatcactggaggcc
atacgcacggtggtggccagcggcaagatctgtgtgctcaacctgcatccgcagagcctc
aagctgctgcgcgcctctgacctcaagccgtacgtggtgctggtggcgccgcccagcttg
gacaagctgcgccaaaagaagctgcgcaacggcgaacccttcaaggaggaagagctcaaa
gacatcattgccacggccagggatatggaggcccgttggggtcacctattcgacatgatc
atcattaacaatgacacggagcgcgcctaccaccaactgctggccgagatcaactcgctg
gagcgcgagccccaatgggtgcccgcccagtgggtgcacaacaatcgcgacgagtcataa

  All links  
No link information was found.   
DBGET integrated database retrieval system