KEGG   Drosophila yakuba: Dyak_GE15800Help
Entry
Dyak_GE15800      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
dya  Drosophila yakuba
Pathway
dya00511  Other glycan degradation
dya00520  Amino sugar and nucleotide sugar metabolism
dya00531  Glycosaminoglycan degradation
dya00603  Glycosphingolipid biosynthesis - globo and isoglobo series
dya00604  Glycosphingolipid biosynthesis - ganglio series
dya01100  Metabolic pathways
dya04142  Lysosome
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Dyak_GE15800
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Dyak_GE15800
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    Dyak_GE15800
   00604 Glycosphingolipid biosynthesis - ganglio series
    Dyak_GE15800
   00511 Other glycan degradation
    Dyak_GE15800
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dyak_GE15800
Enzymes [BR:dya01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Dyak_GE15800
Chaperones and folding catalysts [BR:dya03110]
 Intramolecular chaperones
  Others
   Dyak_GE15800
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 APG5
Motif
Other DBs
NCBI-GeneID: 6525276
NCBI-ProteinID: XP_002101112
FlyBase: FBpp0353181 FBgn0233365
UniProt: B4Q014
Position
X
AA seq 628 aa AA seqDB search
MRFSGCNTKYQISKIQFSIAIXNILDLILLLCFAVGAALTRADDGDSDVDAGSASRKWMC
SRTDICTAEGEMVDGLQYAPETFESQRDCRLSCGKYGAIWPMPTGKECTISHRRVRFDPW
KVRFHVVAPGEAATQFLRETNRLFVSNLLKECIRNCTLESSKQILVRSTVANESLVLDWP
TDESYALVVRTTDTATFVDIQAATVYGARHAFETLSNLVTGSLSNGLLMVTTANITDRPA
FPHRGVLLDTARNFVPLKFIRSTLDAMAASKLNVLHWHVVDTHSFPLEITRVPEMQRYGA
YSSSQTYSRQDALNLVKYARLRGIRILIEIDGPSHAGNGWQWGPAAGLGNMSVCLNQSPW
RRFCVQPPCGQLNPLNDHMYAVLKEILEDVAEVGAPEETIHMGGDEVFLPCWNNTDEIRD
GMRARGYDLSEQSFLRLWSQFHQRNLNAWDEINERMYPGIKEPKSVIIWSSHLTDPRYIE
AYLPKERFIIQTWVASQDALNRELLQRGYRLIVSTKNAWYLDHGFWGSTSYYNWRTVYSS
GMPVGRSKDQVLGGEVCMWSEYVDQNSLESRIWPRAGAAAERLWSNPKSSALLAQRRFYR
YRERLLARGIHADAVIPHWCVLHEGQCL
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgcggttcagcggctgtaacacaaaataccaaatatctaaaatccaattttcaattgca
atttaaaatattttagatcttatcctgctgctttgcttcgcggtcggcgctgcgctgacg
cgggcagatgacggcgacagtgacgttgacgccggcagcgccagtaggaaatggatgtgc
agcaggacggacatctgcaccgcggagggggagatggtggacggactgcagtacgcgccg
gagaccttcgagagccagcgggactgccggctgtcctgcggcaagtacggagccatctgg
ccgatgcccacgggcaaggagtgcaccatatcgcacaggcgggtgcgattcgatccgtgg
aaggtgcgcttccatgtggtggcgcccggcgaggcggccacccagttcctcagggagacg
aaccggctgttcgtgtcgaatttgttgaaggagtgcatacgcaactgcacgttggaaagc
agcaagcagatcctggtcaggtccacggtggccaatgagagcctcgtcctggactggccc
accgacgagagctacgccctggtggtgcgtaccacggacacggccacctttgtggacatc
caggcggcaacggtgtacggagcacgtcatgccttcgagacgctgagcaacctggtcacc
ggcagcctgtccaatggcctgctgatggtcaccacggcgaacattaccgatcgtccagcc
ttcccgcatcgcggagtgctactggatacggcccggaactttgtgccccttaagttcata
cgcagcacattggatgcgatggcggccagtaagctgaatgtgctccactggcatgtggtg
gacacgcacagttttccgctggagatcaccagggtgccggagatgcagcgctacggagcg
tactcctcatcgcagacgtactcgcgccaggacgcactgaatctggtcaagtacgcgcga
ctgcgcggcatacggatactgatcgagatcgatggaccctcgcatgcgggcaatggctgg
caatggggtcctgccgccggactgggcaacatgtccgtgtgcctgaaccaatcgccctgg
aggagattctgtgtgcagccaccgtgcggccagctgaatccactgaacgatcacatgtac
gcggtgctcaaagagatcctggaggacgtggccgaggtgggcgctccggaggagaccata
cacatgggcggtgacgaggtgttcctaccctgctggaataacaccgacgagattcgggat
ggcatgagggctcgcggctacgatctcagcgagcagagcttcctgcgcctgtggtcgcag
ttccatcagcggaatctcaatgcctgggatgagattaacgagcgcatgtatccgggcatc
aaggagcccaagtcggtgatcatctggtccagccacctcaccgatccccgctacatcgag
gcctacttgcccaaggagcggttcataatccagacctgggtggcatcgcaggatgccctc
aatcgggagctcttgcagcggggctatcgactgattgtgtccaccaagaatgcctggtac
ctggatcacggtttctggggcagcacgtcgtactacaactggcgcaccgtgtactccagt
ggcatgcccgttggtcgcagcaaggatcaggttctcggcggtgaggtgtgcatgtggagc
gagtacgtcgatcagaactcattggaatcacgaatctggccgcgagctggagcagctgcc
gagcgactgtggtccaatccgaagtcctccgccctgctggcccagagaaggttctaccgc
taccgggagcgactgctggcccgcggaatccatgcggatgcagtgattccgcattggtgc
gtcctccacgaaggacagtgcctctaa

DBGET integrated database retrieval system