KEGG   Drosophila yakuba: Dyak_GE15844Help
Entry
Dyak_GE15844      CDS       T01068                                 

Gene name
dyak_GLEANR_17320
Definition
(RefSeq) GE15844 gene product from transcript GE15844-RA
  KO
K20792  
N-alpha-acetyltransferase 15/16, NatA auxiliary subunit
Organism
dya  Drosophila yakuba
Brite
Chromosome [BR:dya03036]
 Eukaryotic Type
  Sister chromatid cohesion proteins
   Other sister chromatid cohesion factors
    Dyak_GE15844 (dyak_GLEANR_17320)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 890 aa AA seqDB search
MPSSDPLPPKEGALFRKLLKCYELKQYKNGLKLAKQILSNPKYTEHGETLAMKGLTLNGL
GRREEAYKYVRLGLRNDLRSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWEKDNLQILKD
LSLLQIQMRDLEGYKETRHHLFTLRPSQHASWIGFAMSYHLLRDYDMANSILETFSQSQT
SIEAHDYRHSELLLYQNQILIESDRLQQAVDHLTKYQAQIVDKLAVRETMGDLYIKLQQQ
EKAVPIFESLIRRNPENVLYYEQYIAARQVTDSSAVVSIYRVFQEQYPRALCPRRLPLNI
ANGAEFRVVTDEYLRRGLRKGIPPLFVNVRTLHQIPEKAAVIEELALQYFENLTRSGHFS
REDADAGVPVEPASALVWTALFLAQHYDYMRDTDRALEYINVAIDHTPTLIELLITKGRI
FKHAGDPVEAYVWLEEAQSMDTADRYINSKCAKYMLRANMVQEAEEICAKFTREGVSAMD
NLNEMQCMWFQTECALAYQRMGRWGESLKKCHEVERHFAEIVEDQFDFHTYCMRKMTLRA
YVGLLRLEDVLRQHPFYFKAAKCAIEVYIRLYDKPLKSETTIEEIDIENLPPSELKKLRS
KQRKAKKKAELESAQAAQAQVKREQHQKSKQQANQETDPDAPQLDELVAEKLERTDDPLE
KAIDFLKPLQQLAKERIETHLLAFEVYYRKNKLLLMLQCIRRARAVDPAHPEVHSCIIRF
VKSLTIAAKEQPFNEHVQQVLDKATKELIGSKTPQQLNDEFIAKHNASILHLYEGARSLY
ELDNSKKAAAIKLVTSFNLTKLRLEEATKIYTALRDGDVFGECEAEAASYQQACHERFQY
ARIFRNVEELEAQLQEKEAAKLRAEEEQQQLIHVDSSEPVSVLATAAAAS
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atgccttccagcgatcccctgccgcccaaggagggtgcgctcttccgcaagctacttaaa
tgctacgaactgaagcagtacaaaaatggccttaaactggccaagcagatcctgtccaac
cccaagtacacggagcacggcgagacgctggccatgaaggggctcaccctgaacggactg
ggtcgccgcgaggaggcctacaagtatgtgcgtctgggtctgcgcaacgacctgcgctcc
cacgtctgctggcacgtctacggactgcttcagcgtagcgacaagaagtacgacgaggcc
atcaagtgctaccgcaacgcgctcaagtgggagaaggacaacctgcagatcctgaaggac
ctgtcgctcctccagatccaaatgcgcgacctcgagggctacaaggagacgcgccaccac
ctgttcacgctgcgtccctcgcagcacgcctcctggatcggtttcgccatgagctaccat
ctgctgcgtgactacgacatggccaacagcatcctggagacgttcagccagtcgcagacg
tcgattgaggcgcacgattaccgccactcggagctgctgctctaccagaaccagatactc
atcgagtcggatcgtctgcagcaggccgtggaccacctgaccaagtaccaggcccagatc
gtcgacaagctggccgttcgcgagaccatgggcgatctgtacattaagctgcagcagcag
gagaaggctgtgcccatctttgagtctctgatccgccgcaatccagagaacgtgctctac
tacgagcagtacattgccgcccgccaggtgaccgactcaagtgccgtcgtgtcgatttat
cgcgtgttccaggagcagtatccgcgcgccctttgccctcgccgcctgcctttgaacatc
gccaacggcgccgagttccgcgtcgtgaccgacgagtacctgcgccgcggtctgcgtaag
ggcattccgccgctatttgtcaacgtgcgcactctgcaccagattccggagaaggcggcc
gtcatcgaggagctggcgctgcagtatttcgagaaccttacccgttccggccacttttct
cgcgaagatgccgacgccggggttcccgtcgagccggcctcggctctggtgtggacggca
ctgtttctggcgcagcactacgactacatgcgtgatacggaccgcgcactggagtacatc
aatgtggcgatcgatcatacgccaacactcattgagctgctcatcaccaagggtcgtatc
ttcaagcatgccggcgatcccgtggaggcgtacgtctggctggaggaagcccagagcatg
gacacggcggatcgctacatcaattcgaagtgcgccaagtacatgctgcgcgccaacatg
gtgcaggaggcagaggagatctgcgcgaagttcacccgcgagggtgtctccgccatggat
aacttgaacgagatgcagtgcatgtggttccagacggagtgtgccctggcctatcagcgc
atgggtcgctggggcgagtcgttgaagaagtgccacgaggtggagcgccactttgccgag
attgtcgaagaccagttcgattttcacacctactgcatgcgtaaaatgacgctgcgtgcc
tacgttggcttgctgcgactggaggacgtgctgcgccagcatccattctatttcaaggcg
gccaagtgcgcaatcgaggtgtacattcgtctgtacgacaagccgcttaagtcagagaca
accattgaggagattgacattgagaacctgcccccctcggaactgaagaagctgcgcagc
aaacagcgcaaggccaagaagaaagccgagctggagagtgcgcaggccgcacaggcgcag
gtgaagcgcgagcagcaccagaagtcgaagcagcaggcgaaccaggagaccgaccccgat
gctccgcagttggacgagctggtggccgagaagctggagcgcacggacgatccgctggag
aaggccattgacttcttgaagccgctgcagcagctggctaaggagcgcatcgagacgcac
ctgctggccttcgaggtgtactaccgcaagaataaactgctcctaatgctgcagtgcatc
cggcgcgctcgcgccgtcgatcccgcgcaccccgaagtccacagctgcattattcgcttc
gttaagtcgttaaccatcgccgccaaggagcagccgttcaatgagcacgtacaacaggtg
ctggacaaggccaccaaagaactgataggcagcaagacgccccagcagctcaacgacgag
ttcattgccaaacacaacgcttccatactgcatttatacgagggcgcccgcagtctgtac
gagctggacaatagtaaaaaggccgccgccatcaagctggtcactagcttcaacctgacc
aagctccggctggaggaggccaccaaaatctacacagcgttgcgggacggcgatgtgttt
ggcgagtgcgaggcagaggccgcttcctatcagcaggcgtgccacgaacgtttccagtac
gcccgaatctttcgcaatgtcgaggagctggaggctcagctgcaggagaaggaggccgcc
aagctgcgcgccgaggaggagcagcagcagttgattcacgttgattctagtgaaccggtg
tccgttttggcaacggcagcggcagcgtcttag

DBGET integrated database retrieval system