KEGG   Drosophila yakuba: Dyak_GE15872Help
Entry
Dyak_GE15872      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K14527  ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
dya  Drosophila yakuba
Pathway
dya03008  Ribosome biogenesis in eukaryotes
dya03013  RNA transport
Brite
KEGG Orthology (KO) [BR:dya00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dyak_GE15872
   03008 Ribosome biogenesis in eukaryotes
    Dyak_GE15872
Enzymes [BR:dya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     Dyak_GE15872
Ribosome biogenesis [BR:dya03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     Dyak_GE15872
Transfer RNA biogenesis [BR:dya03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    Dyak_GE15872
Mitochondrial biogenesis [BR:dya03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    Dyak_GE15872
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tmemb_185A
Motif
Other DBs
NCBI-GeneID: 6525135
NCBI-ProteinID: XP_015046112
FlyBase: FBpp0359137 FBgn0233433
UniProt: A0A0R1EAR1
Position
X
AA seq 148 aa AA seqDB search
MFKLSELVRWLGLTEFEILVNLCGLLVFTITLAVKLHLQARAGPGGILPEPMGDWFTVFS
PLFFIDICNAYFCVIVGIRMYLDSNNKRKALHRFMWSTYFLVLIAIFKYLLCLKLSSKTG
LEYSEVFSPIFVLLQLVAVRACQLPNSI
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagctctcggagctggtgcgctggctggggctcaccgagttcgagatcctggtc
aacctgtgcggcctgctggtgttcaccatcacgctggccgttaagctccatctgcaggcc
agggccggacccggcggcatccttccggagcccatgggcgactggttcaccgtcttcagc
cccctgttcttcatcgacatatgcaacgcgtacttctgcgtcatcgtaggcatccgcatg
tacctggactccaacaacaagcgcaaagccctgcaccgcttcatgtggagcacgtatttc
ctggtgctcatcgccatcttcaagtacctgctctgtctgaagctctccagcaagacgggc
ctcgagtactcggaggtcttctcgccgatcttcgtcctactgcagctcgtggcggtgcgt
gcctgccagttgcccaactccatctaa

DBGET integrated database retrieval system