KEGG   Drosophila yakuba: Dyak_GE15936Help
Entry
Dyak_GE15936      CDS       T01068                                 

Definition
GE15936 gene product from transcript GE15936-RA
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
dya  Drosophila yakuba
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:dya00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 641 aa AA seqDB search
MTANTTTSEENLLRSGGQPQEPSTPTSDAEVGGGTPNELSEIFFVDNSRRKQSIKIQVKL
CPEGVYLRRETDEDDHINEQLIRIDDIIGSRYGPRLKKRARGGLNSCRNPNVPGQEADPE
PDSDNSAYLYIYAYLKKEKPLRRVQTLRILRFRSSNDYGVNLQTAELWHLTIRKHKRGNG
SSSPADCGKPLLILLNPKSGSGKGRELFQKQVAPLLTEAEVQYDLQITTHPQFAKEFVRT
RRDLLERYSGIVVASGDGLFYEVLNGLMERMDWHRACRQLPLGIIPCGSGNGLAKSVAHH
CNEPYEPKPILHATLTCMAGKSTPMDVVRVELAPGDKHFVMYSFLSVGWGLIADIDIESE
RLRSIGAQRFTLWAIKRLIGLRSYKGRVSYLLAKDRKEPPVEAAKEAREIPVESDQQKRP
SLPLNAGEFHDLPEEEEGDLDGEQFADAISLDRSVYRQHADSWHSAMSRRTAYYSVGGPS
MRSNRSRMSISQRIEAANAEFAEKVPTGTIPGLQMPLPSSEGWICEDGDFVMVHAAYTTH
LSSDVFFAPDSRLNDGLIYLVIIRSGVSRHQLLNFMLSLNTGTHLPIGEDPFIKVVPCRA
FRIEPSSTDGILAVDGERVDYGPIQAEVMPGLINVMTTMGQ
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgacggccaacacaacgacgtcggaggaaaatctgctgcgaagtggcggacagccgcag
gagccctccacgcccacctcggatgcagaagtgggcggtggcacgcccaacgaactgagc
gagatcttcttcgtggacaacagccggcgcaagcagagcatcaaaatccaggtgaaactc
tgcccggaaggggtttacctgcgtcgcgagaccgacgaggatgatcacatcaatgagcag
ctcatcaggatcgatgatatcattggatcgcgctacggtccgcgattgaagaagcgggcg
cgtggtggcctaaactcctgccggaatccaaatgtaccgggccaggaggcggatccggaa
ccggatagcgataatagcgcctatttgtacatctatgcgtatctgaagaaggagaagccg
ctgcggcgtgtccaaacgctcaggattctacgctttcgatcgagcaatgactatggcgtg
aatctgcagaccgccgagctgtggcatctgacgatacggaagcacaagcgcggcaatggc
agcagttcgcccgccgattgtggcaaaccgttgctcatactcctgaatccgaaatccggc
tctggcaagggtcgtgagctcttccagaagcaggtggcacctttgctgacggaagccgag
gtgcaatacgatctacagatcaccacacatccgcagtttgccaaggagttcgtgcggacc
agaagggatctgttggagcgatattcgggcattgttgtggcctccggcgatggtctattc
tacgaagtgctcaatgggctgatggagcgcatggattggcacagagcctgcaggcaactg
ccacttggcatcattccatgtggctccggtaatggtttggcaaaaagtgtggcccatcac
tgcaacgaaccgtatgaaccgaagcccattctacacgccaccttgacttgcatggcggga
aagagcacacccatggatgtggtcagagtggaactggcaccgggggataagcactttgtg
atgtactctttcctgtcggtgggctggggcctgatagccgacatcgatatagaaagcgag
cgattgcgatcgattggagcgcagagattcacgctttgggccatcaagaggttaattggc
ttgcgcagctacaagggccgggtgtcctacctactggccaaggacagaaaggaaccacca
gtggaagcggcaaaggaggctcgagagattcccgtagaatcagaccagcagaagcgaccg
tctttgccattgaatgccggggaattccatgatctacccgaggaggaggagggggatctg
gatggagaacagttcgccgacgctatatccctggatcgttcggtttatcgccagcatgcc
gacagttggcactcggccatgtccaggagaacggcctattactccgtgggaggacccagt
atgcgatccaatcgcagccgaatgagcattagccagcgaatcgaggcggccaatgcggaa
ttcgcagagaaggtgccaacgggcaccattcccggattacagatgccgctgcccagtagc
gagggttggatctgcgaggatggtgactttgtgatggtccatgccgcctataccacccat
ctctcctccgacgtcttctttgcccccgattcccgactgaacgatggcctcatctacctg
gtgataatccggagtggcgttagtcgccatcagctgctcaatttcatgctgagcctgaac
acaggcacccatctgcccatcggcgaggatccgttcatcaaggtggtgccatgtcgggca
ttccgcatcgagccgagcagcaccgatggcatcctggcggtggacggcgagcgggtggat
tacggacccattcaggcggaggtgatgcccggcctgatcaatgtgatgaccaccatgggt
cagtag

DBGET integrated database retrieval system