KEGG   Drosophila yakuba: Dyak_GE15936Help
Entry
Dyak_GE15936      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
dya  Drosophila yakuba
Pathway
dya00600  Sphingolipid metabolism
dya01100  Metabolic pathways
Module
dya_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dyak_GE15936
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     Dyak_GE15936
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 6525023
NCBI-ProteinID: XP_002100862
FlyBase: FBpp0260946 FBgn0233493
UniProt: B4PYA8
Position
X
AA seq 641 aa AA seqDB search
MTANTTTSEENLLRSGGQPQEPSTPTSDAEVGGGTPNELSEIFFVDNSRRKQSIKIQVKL
CPEGVYLRRETDEDDHINEQLIRIDDIIGSRYGPRLKKRARGGLNSCRNPNVPGQEADPE
PDSDNSAYLYIYAYLKKEKPLRRVQTLRILRFRSSNDYGVNLQTAELWHLTIRKHKRGNG
SSSPADCGKPLLILLNPKSGSGKGRELFQKQVAPLLTEAEVQYDLQITTHPQFAKEFVRT
RRDLLERYSGIVVASGDGLFYEVLNGLMERMDWHRACRQLPLGIIPCGSGNGLAKSVAHH
CNEPYEPKPILHATLTCMAGKSTPMDVVRVELAPGDKHFVMYSFLSVGWGLIADIDIESE
RLRSIGAQRFTLWAIKRLIGLRSYKGRVSYLLAKDRKEPPVEAAKEAREIPVESDQQKRP
SLPLNAGEFHDLPEEEEGDLDGEQFADAISLDRSVYRQHADSWHSAMSRRTAYYSVGGPS
MRSNRSRMSISQRIEAANAEFAEKVPTGTIPGLQMPLPSSEGWICEDGDFVMVHAAYTTH
LSSDVFFAPDSRLNDGLIYLVIIRSGVSRHQLLNFMLSLNTGTHLPIGEDPFIKVVPCRA
FRIEPSSTDGILAVDGERVDYGPIQAEVMPGLINVMTTMGQ
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgacggccaacacaacgacgtcggaggaaaatctgctgcgaagtggcggacagccgcag
gagccctccacgcccacctcggatgcagaagtgggcggtggcacgcccaacgaactgagc
gagatcttcttcgtggacaacagccggcgcaagcagagcatcaaaatccaggtgaaactc
tgcccggaaggggtttacctgcgtcgcgagaccgacgaggatgatcacatcaatgagcag
ctcatcaggatcgatgatatcattggatcgcgctacggtccgcgattgaagaagcgggcg
cgtggtggcctaaactcctgccggaatccaaatgtaccgggccaggaggcggatccggaa
ccggatagcgataatagcgcctatttgtacatctatgcgtatctgaagaaggagaagccg
ctgcggcgtgtccaaacgctcaggattctacgctttcgatcgagcaatgactatggcgtg
aatctgcagaccgccgagctgtggcatctgacgatacggaagcacaagcgcggcaatggc
agcagttcgcccgccgattgtggcaaaccgttgctcatactcctgaatccgaaatccggc
tctggcaagggtcgtgagctcttccagaagcaggtggcacctttgctgacggaagccgag
gtgcaatacgatctacagatcaccacacatccgcagtttgccaaggagttcgtgcggacc
agaagggatctgttggagcgatattcgggcattgttgtggcctccggcgatggtctattc
tacgaagtgctcaatgggctgatggagcgcatggattggcacagagcctgcaggcaactg
ccacttggcatcattccatgtggctccggtaatggtttggcaaaaagtgtggcccatcac
tgcaacgaaccgtatgaaccgaagcccattctacacgccaccttgacttgcatggcggga
aagagcacacccatggatgtggtcagagtggaactggcaccgggggataagcactttgtg
atgtactctttcctgtcggtgggctggggcctgatagccgacatcgatatagaaagcgag
cgattgcgatcgattggagcgcagagattcacgctttgggccatcaagaggttaattggc
ttgcgcagctacaagggccgggtgtcctacctactggccaaggacagaaaggaaccacca
gtggaagcggcaaaggaggctcgagagattcccgtagaatcagaccagcagaagcgaccg
tctttgccattgaatgccggggaattccatgatctacccgaggaggaggagggggatctg
gatggagaacagttcgccgacgctatatccctggatcgttcggtttatcgccagcatgcc
gacagttggcactcggccatgtccaggagaacggcctattactccgtgggaggacccagt
atgcgatccaatcgcagccgaatgagcattagccagcgaatcgaggcggccaatgcggaa
ttcgcagagaaggtgccaacgggcaccattcccggattacagatgccgctgcccagtagc
gagggttggatctgcgaggatggtgactttgtgatggtccatgccgcctataccacccat
ctctcctccgacgtcttctttgcccccgattcccgactgaacgatggcctcatctacctg
gtgataatccggagtggcgttagtcgccatcagctgctcaatttcatgctgagcctgaac
acaggcacccatctgcccatcggcgaggatccgttcatcaaggtggtgccatgtcgggca
ttccgcatcgagccgagcagcaccgatggcatcctggcggtggacggcgagcgggtggat
tacggacccattcaggcggaggtgatgcccggcctgatcaatgtgatgaccaccatgggt
cagtag

DBGET integrated database retrieval system